KEGG   Methanocella conradii: Mtc_1765Help
Entry
Mtc_1765          CDS       T01774                                 

Gene name
porA-2
Definition
(GenBank) pyruvate ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mez  Methanocella conradii
Pathway
mez00010  Glycolysis / Gluconeogenesis
mez00020  Citrate cycle (TCA cycle)
mez00620  Pyruvate metabolism
mez00640  Propanoate metabolism
mez00650  Butanoate metabolism
mez00680  Methane metabolism
mez00720  Carbon fixation pathways in prokaryotes
mez01100  Metabolic pathways
mez01120  Microbial metabolism in diverse environments
mez01130  Biosynthesis of antibiotics
mez01200  Carbon metabolism
Module
mez_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_1765 (porA-2)
   00020 Citrate cycle (TCA cycle)
    Mtc_1765 (porA-2)
   00620 Pyruvate metabolism
    Mtc_1765 (porA-2)
   00640 Propanoate metabolism
    Mtc_1765 (porA-2)
   00650 Butanoate metabolism
    Mtc_1765 (porA-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mtc_1765 (porA-2)
   00680 Methane metabolism
    Mtc_1765 (porA-2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mtc_1765 (porA-2)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mtc_1765 (porA-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: AFD00509
UniProt: H8I9Q8
Position
complement(1691766..1692863)
Genome map
AA seq 365 aa AA seqDB search
MKKMATGNQAAALAVKESNVEVVAAYPITPQTEVVETIASLVETGKMNASYIRVESEHSA
LAACIGASASGARAFTATSSHGLLYMHEMIHWAAGARLPIVMANINRAIGPAWNIWADHS
DSLSQRDTGWMQFYAATVQEVYDTILMSYRLAEKVCLPAMVCLDGFILSHAIQPLDVTPS
GDFIPPISLPHALDTKNPMSYGNLTGPNDYFKFRRMIHDAMKRADKECREVEREFAERFG
RKYGPVMEYRTDDADTIIVGMGTMAREAEVAVDLLRKEGLKVGSMRVRQFRPFPRLGLEG
KKVVALDRDCSYGAGGILAQEIRFHHDVPVYNIIAGIGGQDVRYEVIAELVRKARPEGEF
WLGVD
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagatggccacgggtaaccaggcggcggcccttgcggtaaaagagtcgaacgtc
gaggtcgtcgccgcgtatccgataactcctcagaccgaggtcgtcgaaaccatagcgagc
ctggtagagacggggaagatgaacgcctcttacataagagtcgagagcgagcattcggct
ctggccgcatgcatcggggcctctgccagtggcgctagggctttcacggccacttcgagc
catggcctgctttacatgcacgagatgatacactgggctgccggagcgcggcttcccatc
gttatggccaatataaaccgggccataggcccagcctggaacatctgggcggaccactca
gactcgctatcccagcgtgacactggctggatgcagttctacgcggcgacggtccaggag
gtgtacgacaccatcctgatgtcctacaggcttgcggagaaggtctgcctgcctgccatg
gtctgcctggatggctttatattgagccacgccatccagccgctagacgtaaccccatca
ggcgatttcataccgccaataagccttccacacgcccttgacaccaaaaacccgatgtct
tatgggaaccttaccgggccaaacgactacttcaagttccggcgcatgatacacgacgcc
atgaagcgggccgataaagagtgccgtgaagtcgagagggagttcgcggagcggtttggc
cgcaagtatggccccgtgatggaataccgtacagatgatgccgatacgataatcgtgggc
atgggcacaatggcccgcgaagcagaggtggcggtagaccttttaagaaaggagggccta
aaagtaggctccatgagggtgaggcagttcaggcctttcccaaggctaggcctggaagga
aagaaggtcgtagcgctggacagggattgctcatacggcgcaggcggcatactggcccag
gaaataaggttccaccatgatgtgcccgtttataatatcatagcgggaattggcggccag
gatgtgaggtatgaggtaatagcggagctggtgcgcaaggcgaggcccgagggcgagttc
tggctgggggtggactaa

DBGET integrated database retrieval system