KEGG   Methanocella conradii: Mtc_1766Help
Entry
Mtc_1766          CDS       T01774                                 

Gene name
porB-2
Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit beta (EC:1.2.7.1)
  KO
K00170  
pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_1766 (porB-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_1766 (porB-2)
   00020 Citrate cycle (TCA cycle)
    Mtc_1766 (porB-2)
   00620 Pyruvate metabolism
    Mtc_1766 (porB-2)
   00640 Propanoate metabolism
    Mtc_1766 (porB-2)
   00650 Butanoate metabolism
    Mtc_1766 (porB-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mtc_1766 (porB-2)
   00680 Methane metabolism
    Mtc_1766 (porB-2)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mtc_1766 (porB-2)
Enzymes [BR:mez01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mtc_1766 (porB-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1692860..1693747)
Genome map
AA seq 295 aa AA seqDB search
MLDDIPQEEYLLKGNTACAGCGAMLALRYILKAAGQNTIIVNPACCSTVCQGTYPKTAYG
VPVLNIAFAAAAAAADGIASARRNKGKNIIVFAGDGGTVDIGIQALSGAIERNANILYIC
YDNEAYSNTGMQKSGSTPYGAITTTTPTGRKDSKKDIDLIIMAHRPKYMASASAAYPKDL
YEKVRKALTIEGTKFIHVLCPCPSGWRYSTEKTVELGRLAVRCGMWFLYEYEDGKVKLNA
PTKAALKRPAPLADYVRPQGRFKGVNLERLQKEVDEEMDRIRALAGIENAKEASE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcttgacgacatcccccaggaagagtacctattaaagggcaataccgcgtgcgccggg
tgcggcgccatgctggctttgcgctatatcctcaaggccgcggggcagaacacgatcatc
gtgaacccggcgtgctgctcgacggtgtgccagggcacctatccaaagaccgcttatggc
gtacccgtattaaacatcgcgttcgcggcggcggccgcggcggcggacggcatcgcctcc
gccaggcggaataagggcaagaacatcatagtcttcgccggcgacggcgggacggtggac
atcggcatacaggccctttctggcgccatcgagcgcaacgccaacatcctatatatttgc
tatgataacgaggcatactcgaacacgggcatgcaaaagagcggctccaccccatatggt
gcgatcacgacgaccacgcccacgggcagaaaagactcgaaaaaggatatagacctcata
ataatggcccacaggcctaagtatatggcaagcgcctccgcggcatacccgaaagacctt
tacgagaaggtcaggaaggcgctaaccatcgaaggcaccaagttcatccatgtattatgc
ccatgcccatctggctggcgctattcgaccgaaaagaccgtggagctgggcaggctggcg
gtcaggtgcggaatgtggttcctctacgagtatgaggatggcaaggttaagctgaatgcc
ccaactaaggctgcgctaaagaggccggcgccccttgcggattacgtgaggccgcaggga
aggtttaagggcgtcaacctcgagcgcctgcaaaaagaggtggacgaggagatggacagg
ataagggcactggcgggcattgagaacgcgaaggaggcgtcggaatga

DBGET integrated database retrieval system