KEGG   Methanocella conradii: Mtc_1947Help
Entry
Mtc_1947          CDS       T01774                                 

Gene name
speB
Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mez  Methanocella conradii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mtc_1947 (speB)
Enzymes [BR:mez01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mtc_1947 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1855746..1856603
Genome map
AA seq 285 aa AA seqDB search
MKGNLFADACSSFDDATFVLFGVPFDGTSSFRTGSRWAPMEMRKASYNFETYNGDLDVDL
VDVPVHDMGDIEAYCSVDDTLDAVYDVASGIVKAGKLPIMMGGEHSLTYPCVKACGKVGF
VVMDAHHDLRQEYGGLRNNHACVSRHIIEDLADRYVSIGIRSGTKEEYEYVRNKGIMSFT
ANDVDAMGIDAVLRETEAYLRGCDRIYLSLDMDAIDPAYAPGLGTPEPFGMTPRQVREVI
RRLAPKTVGFDVVEISPVYDHGVTAILGAKLIRDFIAAKWKSMQA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgaagggaaacctgttcgccgacgcctgcagttcctttgacgatgccactttcgtgctt
ttcggggtgccctttgatggcacttcgtcttttcggactggctccaggtgggcgcccatg
gaaatgaggaaggcctcgtataacttcgagacgtataacggtgacctggacgtggatctc
gtggacgtgccggtgcacgacatgggcgacatcgaggcctactgcagcgttgacgatacg
ctggacgccgtatatgacgttgcgtcgggcatcgttaaggcaggaaagctccccataatg
atgggcggcgagcactcgctcacctatccttgcgttaaggcctgcggcaaagtgggcttc
gtggtaatggacgcccaccatgacctgaggcaggagtatggcggcctcaggaataaccac
gcctgcgtctccaggcacatcattgaggacctcgctgacaggtatgtatctataggcata
aggagcggcactaaagaagagtatgagtacgtgaggaataagggaatcatgtcttttacc
gctaacgatgtcgatgcaatgggcattgacgccgtgctcagggagactgaagcgtacctg
aggggctgcgacaggatatacctttcattagatatggatgccatcgacccagcatatgcc
cctggactggggacgccggaaccattcggcatgactccccgtcaagtgagggaggtcatc
aggcgcctggccccaaagaccgttggtttcgacgtcgtggagatatcccccgtgtatgac
cacggcgtgaccgccatcctcggagcaaagctcatcagggacttcatagcggcaaagtgg
aagtcgatgcaagcttaa

DBGET integrated database retrieval system