KEGG   Methanocella conradii: Mtc_2021Help
Entry
Mtc_2021          CDS       T01774                                 

Gene name
thrC-2
Definition
L-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mez  Methanocella conradii
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mtc_2021 (thrC-2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mtc_2021 (thrC-2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mtc_2021 (thrC-2)
Enzymes [BR:mez01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mtc_2021 (thrC-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1923682..1924845)
Genome map
AA seq 387 aa AA seqDB search
MRIDHLQCARCGRKYPKDELRYRCDCGDSIEIVYDYGELAGRISWADLRKRTFCHWRYRE
FYPGLNKRNIITMGEGGTSLVKSRSIAKKAGCRELLFKMESLNPTGSFKDRGSTVEISQA
CQYGARELVLASTGNMGASVAAYCARGGIGCTIYVPWSTPEVKLLQMEAHGAIIKRVRGD
YTAAALEARSQFEKRGVYLAGDYPYRSEGEKSVGFEIADALGTDYDYIACPIGNGTLLHG
IWKGLKEFKMMGLIDRLPRILGVQAEGCNTVVKAFQDNKEIIEPVQPHTLMDAVACGDPL
DGSWALKALRESGGIGIAVSDDEAIRVRDMLAREEGIFAELSGALSTAGLMKAYENGMIE
KGLKVVSLVTGHGLKEPEAARYRPSKP
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcgatcacctccagtgcgcccgctgcggcaggaaatacccgaaagacgagcta
aggtataggtgcgactgcggggacagcattgagatagtatacgactatggagagcttgcc
ggcaggattagctgggcagacctcaggaagaggacgttttgccactggaggtacagggag
ttttatccgggccttaataagaggaatatcattaccatgggtgagggaggcaccagcctt
gttaagtcgaggagcattgctaaaaaggcggggtgcagagagcttttatttaagatggag
agcctcaacccgaccgggtcttttaaggaccggggctcgacagtggagatatcgcaggcc
tgccagtatggtgcccgcgagcttgtgctggcgtctacgggcaacatgggcgcgagcgtg
gcggcatactgtgcaaggggcggcatcggctgtacgatatacgtgccgtggagcactccg
gaggttaagctgctccagatggaggcgcatggggcgatcattaaaagagtgaggggagac
tatactgccgctgcgcttgaggccagaagccagtttgagaagaggggcgtatacttagcg
ggcgactatccgtacaggagcgagggggagaagtcggtgggctttgagatagcggacgcg
ctgggcactgattacgattacatcgcgtgccctatagggaatggcacgcttttgcatggc
atatggaaaggcttgaaagaatttaagatgatggggctgatcgataggctgcccaggata
ctgggggtgcaggccgagggttgtaatactgtcgttaaggcatttcaagacaataaggag
attatagagcctgtccagccgcacacgctcatggacgcggtggcctgcggcgaccctctg
gatgggagctgggcgctcaaggcgctgagggagtcgggaggcatcggaatagcggtctct
gacgatgaggcaatccgcgtgcgtgacatgcttgccagggaggagggcatttttgcagag
ctgtcgggcgcattgagcacggccgggctcatgaaggcgtatgagaacggtatgatagaa
aagggcctgaaagtggtctcgctggtcaccggccacggcctgaaggagccggaggcggcc
aggtaccggccatctaaaccttga

DBGET integrated database retrieval system