KEGG   Methanocella conradii: Mtc_2103Help
Entry
Mtc_2103          CDS       T01774                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mez  Methanocella conradii
Brite
Enzymes [BR:mez01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mtc_2103
Transfer RNA biogenesis [BR:mez03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mtc_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1996404..1998026
Genome map
AA seq 540 aa AA seqDB search
MSSCIRCIGMDSTMAACRELVDLILSGDVSTQDELNKAKKMVSAAYHLSKLPRNSDILSA
AGDDRDAVLDLLQKRPIRTISGVAVIAVMTSPYRCPHGRCVPCPGGVDSIFNSPQSYTGA
EPAALRAIQENYDPYRQVTARLSQLKQIGHKLDKAELIIMGGTITARPLDYQQWFVKRCL
DAMNDFGREPLHTKYLEDAQRANETAAVRNVAMTFETRPDWCKERHIDRMLDMGVTKVEL
GVQSTYDFILKRIERGHTVADSVEANRALRDSAIKVGFHMMPGLPGSNMERDLRMFEALF
NDSRFCPDYLKIYPTLVTKGTRLYDMWERGEYVPYSSEEAARLLADIKERLPAWVRLQRI
QRDIPAKHIVAGVLKSNVRQMAYDIMQAEGKRCRCIRCREVGHKMLKGLRADPDAVRLGV
EKYEACGGVEHFIFFEEFNIDALIGFIRLRFPCRPHRPELEDAALIRELHVYGRMVPIGE
KGKDWQHRGYGAELLERAASIAREAGYGKLAVMSGVGARPYYERLGFGRDGPYMSRRLRP
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcatgcataaggtgcatcggcatggatagtacgatggctgcttgccgggagctg
gtcgacctcatcctgtcgggcgacgtgtccacgcaggatgagctaaataaggcgaagaag
atggttagcgcagcgtatcatctttctaagctgccccgtaactcggacattttaagcgcc
gctggagatgaccgggatgcggtattggatttgcttcagaagcgtcctattcggacgatt
tccggggtggcggtcatcgcggtcatgacgtctccgtatagatgcccgcatggcaggtgc
gtcccctgcccgggaggcgtggactccatttttaattcgccgcagagctacacgggagcc
gagccggccgccctcagggcaatacaggagaactacgacccctacaggcaggtcaccgca
cggctgagccagctaaagcaaatcggccacaagcttgacaaggccgagctgatcatcatg
gggggcaccatcacggccaggccgcttgactaccagcagtggttcgtgaagcggtgcctg
gacgccatgaacgattttggcagagagccgcttcatacaaagtacctggaggacgcccag
agggcgaacgagacggctgccgtcagaaacgtggccatgaccttcgagacacggccggac
tggtgtaaggagcgccatattgaccgcatgctggacatgggcgtgacgaaagtcgagctg
ggcgtgcagagcacctatgacttcatattaaaaaggatcgagcgagggcacacggtggcg
gacagcgtggaggccaaccgggcgctgcgcgactcggccattaaggtaggatttcacatg
atgccggggctgcccgggtcgaacatggagagggacctgcgcatgttcgaggcgctcttt
aatgacagccggttctgtcctgattatttgaagatttatccgacgctcgtcacaaagggc
acgaggctctatgatatgtgggagaggggagagtacgtgccatattccagcgaggaggcg
gccaggctgcttgcggacataaaggagcgcctgcccgcctgggtgaggctgcagcgcata
cagagggacatacccgcaaagcacatcgtggccggcgtgttgaagagcaacgtgcgccag
atggcatatgatattatgcaagcggaggggaagcggtgccggtgcataaggtgtcgcgag
gtcggccataaaatgcttaaagggttgagggcggacccggatgcggtcaggcttggggtg
gagaagtatgaggcgtgcggcggcgtggagcacttcatattcttcgaggagtttaatata
gatgccctaatcggctttataaggttaaggttcccgtgccgcccccatcgtcctgagctt
gaggatgccgctctcatccgcgagcttcatgtctacggccggatggtgcccataggcgag
aagggcaaggactggcagcacaggggctatggcgcagagcttttggagcgtgccgccagc
attgccagagaggccggatacggcaagctggcggtcatgagcggcgtaggggcgcggcct
tactatgaaaggctgggcttcgggcgtgacgggccatacatgtccaggcggctccggccc
tga

DBGET integrated database retrieval system