KEGG   Methanocella conradii: Mtc_2108Help
Entry
Mtc_2108          CDS       T01774                                 

Gene name
pfkB-3
Definition
carbohydrate kinase, pfkB family (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mez  Methanocella conradii
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Mtc_2108 (pfkB-3)
Enzymes [BR:mez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Mtc_2108 (pfkB-3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2002596..2003540)
Genome map
AA seq 314 aa AA seqDB search
MPRIATVGDVNVDLIARIDRMPEMGKQVITRDFQTHGGGCSANFSLSCARLGMEVQLFGK
VGDDVFGRYVLIELEDNGVDTKNVRMTEQKTGVTVAIVQGIERSFITFRGENATFCLDDI
DVSKISADMVHLPSYFLMDALRDGYVKLIDLLHAAGVKVSFDTGWDPRGFIPETVEPLFR
ILPRVDVFLPNLDEARSILGLGPDVGPEKAAEILLDMGVKVVAIKMGKDGCWVADRERIE
YVPAFQVKVVDTTGAGDNFDAGFICSYISGRPLRECAIIGSATAALKIGGIGWSTYPTRK
QVNTFLAGKGFKGL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgccgagaatagccaccgtaggggacgtcaacgtcgacctcatcgcacggatagacagg
atgcccgagatggggaagcaggtgatcacaagggatttccagacccatgggggaggctgt
tccgccaatttctctctctcatgtgcgcggctcgggatggaggtccagctattcggcaag
gttggggacgacgttttcggcagatacgtgctcatcgagcttgaagataacggggtggat
actaaaaacgtgcggatgacggagcagaagacgggcgtcacggtggccatcgtccagggc
atcgagcgttctttcataacgtttcgaggggagaatgcgactttttgcctagatgacata
gatgtttcgaagattagcgctgacatggtgcatctaccgtcgtactttttgatggacgcg
ctgcgggatggctatgttaagctcatcgatttgttgcatgcggcgggcgtgaaggtgtca
tttgatactggctgggaccccagggggttcattcccgagactgtggagccgctcttcagg
atactcccgcgggtagacgtgttccttccgaacctggatgaggcgaggagcatactgggg
ctggggcctgatgtgggacctgaaaaggccgcggagatactgctggacatgggggttaag
gtcgtcgccatcaagatggggaaggacggatgctgggtggccgaccgtgaaaggattgag
tacgtgcccgcatttcaggtgaaggtggttgacaccaccggcgcgggagataactttgac
gcgggcttcatatgctcttatatcagtggcaggcctctgagggagtgcgccatcatcggc
agcgcaaccgccgccctcaagataggcggcatagggtggtctacctatccgacgcgcaaa
caggtcaatacttttttagccgggaaaggctttaaaggcttatga

DBGET integrated database retrieval system