KEGG   Methanocella conradii: Mtc_2143Help
Entry
Mtc_2143          CDS       T01774                                 

Gene name
rpoH
Definition
DNA-directed RNA polymerase subunit H (EC:2.7.7.6)
Orthology
K03053  
DNA-directed RNA polymerase subunit H [EC:2.7.7.6]
Organism
mez  Methanocella conradii
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Module
RNA polymerase, archaea
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mtc_2143 (rpoH)
   00240 Pyrimidine metabolism
    Mtc_2143 (rpoH)
 Genetic Information Processing
  Transcription
   03020 RNA polymerase
    Mtc_2143 (rpoH)
Enzymes [BR:mez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     Mtc_2143 (rpoH)
Transcription machinery [BR:mez03021]
 Prokaryotic type
  Archaeal type
   RNA polymerase
    Core subunits
     Mtc_2143 (rpoH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2040649..2040888
Genome map
AA seq 79 aa AA seqDB search
MTKKFNVLEHELVPDHILLTEEETQEVLKKYGITRGQLPKIKASDVVVKQIGAKPGDVIK
IIRKSLTAGRAVAYRLVIE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaagaagttcaacgttctggaacacgagctggtgccagaccatatcctgttgact
gaagaagagacccaggaagtactgaaaaaatatggaataacaaggggacagttgcctaag
ataaaagcctccgacgtcgtggtcaagcagataggcgctaagcctggcgacgttataaag
atcatcaggaagagcctgaccgccggcagggcagtcgcttacaggctcgtcatagagtaa

DBGET integrated database retrieval system