KEGG   Methanocella conradii HZ254: Mtc_2143Help
Entry
Mtc_2143          CDS       T01774                                 

Gene name
rpoH
Definition
DNA-directed RNA polymerase subunit H (EC:2.7.7.6)
Orthology
K03053  
DNA-directed RNA polymerase subunit H [EC:2.7.7.6]
Organism
mez  Methanocella conradii HZ254
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
RNA polymerase
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:mez00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mez00240]
Genetic Information Processing; Transcription; RNA polymerase [PATH:mez03020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2040649..2040888
Genome map
AA seq 79 aa AA seqDB search
MTKKFNVLEHELVPDHILLTEEETQEVLKKYGITRGQLPKIKASDVVVKQIGAKPGDVIK
IIRKSLTAGRAVAYRLVIE
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
ttgaccaagaagttcaacgttctggaacacgagctggtgccagaccatatcctgttgact
gaagaagagacccaggaagtactgaaaaaatatggaataacaaggggacagttgcctaag
ataaaagcctccgacgtcgtggtcaagcagataggcgctaagcctggcgacgttataaag
atcatcaggaagagcctgaccgccggcagggcagtcgcttacaggctcgtcatagagtaa

DBGET integrated database retrieval system