KEGG   Methanocella conradii: Mtc_2228Help
Entry
Mtc_2228          CDS       T01774                                 

Gene name
acs-2
Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_2228 (acs-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_2228 (acs-2)
   00620 Pyruvate metabolism
    Mtc_2228 (acs-2)
   00640 Propanoate metabolism
    Mtc_2228 (acs-2)
  Energy metabolism
   00680 Methane metabolism
    Mtc_2228 (acs-2)
Enzymes [BR:mez01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mtc_2228 (acs-2)
Lipid biosynthesis proteins [BR:mez01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mtc_2228 (acs-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2114658..2116397
Genome map
AA seq 579 aa AA seqDB search
MENGVEIVEMIGDCNVCYDEVCRNGFCFDDVKKEFDWYKTGKVNIAHEAIDRHAKSWRKN
KVALYWEGADGSDRKYTFQELKIRTDKLANVLKNAGVKKGDRVFVYLPRIPELYASAIAI
AKVGAIFAPLFGGFRADAVRDRINDAEACMVITTPEMKRLGIDPIRKEIPSVKNILLCNI
PRNYDLEPGDLSYDAEMIYASEQFEPEWCDLEDPVIMHYTSGTTGKSKGVVHVHNAMIGH
YITTRWVQDLRDDDVFWCTADPGWVTGTSYGIFGPWLNGASQVVYAGRFSPEAWYWVIDK
YKVTVWYTAPTALRMLMKAGDEVVKKYHLDSLRYITSVGEPLNPEVIRWAMRVYGLPIHE
NYWMTETGCNVIANFYSLPLKVGSMGKPFPGIEAAVVDDKGRVLPPGVPGNIVIKPGWPS
MMRGIWNNPEKYSEYFRIPGWYMTGDSGFVDSDGYFWFTGRIDDVIKTSGERVGPFEVES
ALLEHPAVAEAGVIGKPDPLYGNIIKAFISLKPGYEGTDELKREISDFVKTKLAAHAFPR
EIEFKPNLPKTRSGKIMRRVLKAMELGQPLGDLATLDDE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacggagtggaaatcgtagaaatgatcggcgactgcaacgtctgctacgacgag
gtctgccgcaacggcttttgcttcgacgacgtaaaaaaggagttcgactggtacaaaacc
ggcaaggtgaacatcgcgcacgaggcaatagaccgccatgcgaagtcctggcgcaaaaac
aaagtagccctatactgggaaggggctgatggaagcgaccgcaagtacacgttccaggag
ctaaagataaggacggacaagctggcaaacgtgctgaaaaatgccggggtaaagaagggg
gaccgcgtcttcgtatacctgcccaggatacccgagctttacgccagcgccatcgcgata
gcaaaagtgggcgccatattcgcgccgcttttcgggggcttcagggcggatgcggtccga
gaccgcataaacgacgcggaggcatgcatggtcatcacgacgcccgagatgaagcgccta
ggcatcgaccccataaggaaggagataccatcggttaagaacatattgctgtgcaacata
ccccggaactacgacctggagccgggagacctgagctacgacgcagagatgatatacgcc
tccgagcaattcgagcccgagtggtgcgacctcgaagacccggtgataatgcactacacg
tctggcactactggcaagtccaagggagtcgtgcacgtccataacgccatgatagggcac
tacataaccaccaggtgggttcaagacctgagggatgatgacgtgttctggtgtacggct
gacccgggatgggtcacgggcacatcttacggcattttcggcccgtggctgaatggcgcc
tcccaggtggtatacgcaggcaggttctcgcccgaggcgtggtactgggtcatcgataag
tacaaggtgaccgtgtggtatacggccccgacggcgctgcgcatgctcatgaaggcgggc
gacgaggtcgtaaagaaataccacctggacagcctgaggtacatcacgagcgtcggcgag
ccgctaaacccagaggtcatccgctgggccatgcgcgtctacgggctgcccatccacgag
aactactggatgacggagacgggctgtaacgttatcgctaacttctacagcctgccgctc
aaggttggctccatgggcaagccattcccgggcatagaggccgcggtcgtggacgataag
ggaagggtactgcctccaggcgtgcccggcaacatcgtgataaagccaggctggccttcc
atgatgaggggcatatggaataacccggagaaatatagcgaatacttcaggataccaggc
tggtatatgacaggagatagcggcttcgttgactccgatggctacttctggttcaccggc
cgcatcgacgacgtcataaagacctcgggggagcgcgtcgggccattcgaggtggagagc
gccctgctcgagcaccctgcggtggccgaggcgggcgtcatcggcaagcccgatccactg
tatggtaacatcatcaaggccttcatatcgctgaagccgggctacgagggcacggatgag
cttaagagagagatatcagacttcgttaagacaaagctagccgcccatgcattcccacgg
gagatagagtttaagcccaacctgccaaagaccaggagcggtaagatcatgcgtcgtgtg
ctaaaggccatggagctgggccagccgttgggcgacctggccacgctagacgacgagtag

DBGET integrated database retrieval system