KEGG   Methanocella conradii: Mtc_2228Help
Entry
Mtc_2228          CDS       T01774                                 

Gene name
acs-2
Definition
acyl-coenzyme A synthetase/AMP-(fatty) acid ligase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_2228 (acs-2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_2228 (acs-2)
   00620 Pyruvate metabolism
    Mtc_2228 (acs-2)
   00640 Propanoate metabolism
    Mtc_2228 (acs-2)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mtc_2228 (acs-2)
   00680 Methane metabolism
    Mtc_2228 (acs-2)
Enzymes [BR:mez01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mtc_2228 (acs-2)
Lipid biosynthesis proteins [BR:mez01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mtc_2228 (acs-2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2114658..2116397
Genome map
AA seq 579 aa AA seqDB search
MENGVEIVEMIGDCNVCYDEVCRNGFCFDDVKKEFDWYKTGKVNIAHEAIDRHAKSWRKN
KVALYWEGADGSDRKYTFQELKIRTDKLANVLKNAGVKKGDRVFVYLPRIPELYASAIAI
AKVGAIFAPLFGGFRADAVRDRINDAEACMVITTPEMKRLGIDPIRKEIPSVKNILLCNI
PRNYDLEPGDLSYDAEMIYASEQFEPEWCDLEDPVIMHYTSGTTGKSKGVVHVHNAMIGH
YITTRWVQDLRDDDVFWCTADPGWVTGTSYGIFGPWLNGASQVVYAGRFSPEAWYWVIDK
YKVTVWYTAPTALRMLMKAGDEVVKKYHLDSLRYITSVGEPLNPEVIRWAMRVYGLPIHE
NYWMTETGCNVIANFYSLPLKVGSMGKPFPGIEAAVVDDKGRVLPPGVPGNIVIKPGWPS
MMRGIWNNPEKYSEYFRIPGWYMTGDSGFVDSDGYFWFTGRIDDVIKTSGERVGPFEVES
ALLEHPAVAEAGVIGKPDPLYGNIIKAFISLKPGYEGTDELKREISDFVKTKLAAHAFPR
EIEFKPNLPKTRSGKIMRRVLKAMELGQPLGDLATLDDE
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacggagtggaaatcgtagaaatgatcggcgactgcaacgtctgctacgacgag
gtctgccgcaacggcttttgcttcgacgacgtaaaaaaggagttcgactggtacaaaacc
ggcaaggtgaacatcgcgcacgaggcaatagaccgccatgcgaagtcctggcgcaaaaac
aaagtagccctatactgggaaggggctgatggaagcgaccgcaagtacacgttccaggag
ctaaagataaggacggacaagctggcaaacgtgctgaaaaatgccggggtaaagaagggg
gaccgcgtcttcgtatacctgcccaggatacccgagctttacgccagcgccatcgcgata
gcaaaagtgggcgccatattcgcgccgcttttcgggggcttcagggcggatgcggtccga
gaccgcataaacgacgcggaggcatgcatggtcatcacgacgcccgagatgaagcgccta
ggcatcgaccccataaggaaggagataccatcggttaagaacatattgctgtgcaacata
ccccggaactacgacctggagccgggagacctgagctacgacgcagagatgatatacgcc
tccgagcaattcgagcccgagtggtgcgacctcgaagacccggtgataatgcactacacg
tctggcactactggcaagtccaagggagtcgtgcacgtccataacgccatgatagggcac
tacataaccaccaggtgggttcaagacctgagggatgatgacgtgttctggtgtacggct
gacccgggatgggtcacgggcacatcttacggcattttcggcccgtggctgaatggcgcc
tcccaggtggtatacgcaggcaggttctcgcccgaggcgtggtactgggtcatcgataag
tacaaggtgaccgtgtggtatacggccccgacggcgctgcgcatgctcatgaaggcgggc
gacgaggtcgtaaagaaataccacctggacagcctgaggtacatcacgagcgtcggcgag
ccgctaaacccagaggtcatccgctgggccatgcgcgtctacgggctgcccatccacgag
aactactggatgacggagacgggctgtaacgttatcgctaacttctacagcctgccgctc
aaggttggctccatgggcaagccattcccgggcatagaggccgcggtcgtggacgataag
ggaagggtactgcctccaggcgtgcccggcaacatcgtgataaagccaggctggccttcc
atgatgaggggcatatggaataacccggagaaatatagcgaatacttcaggataccaggc
tggtatatgacaggagatagcggcttcgttgactccgatggctacttctggttcaccggc
cgcatcgacgacgtcataaagacctcgggggagcgcgtcgggccattcgaggtggagagc
gccctgctcgagcaccctgcggtggccgaggcgggcgtcatcggcaagcccgatccactg
tatggtaacatcatcaaggccttcatatcgctgaagccgggctacgagggcacggatgag
cttaagagagagatatcagacttcgttaagacaaagctagccgcccatgcattcccacgg
gagatagagtttaagcccaacctgccaaagaccaggagcggtaagatcatgcgtcgtgtg
ctaaaggccatggagctgggccagccgttgggcgacctggccacgctagacgacgagtag

DBGET integrated database retrieval system