KEGG   Methanocella conradii: Mtc_2502Help
Entry
Mtc_2502          CDS       T01774                                 

Gene name
pfp
Definition
pyrophosphate-dependent phosphofructokinase (EC:2.7.1.11 2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mez  Methanocella conradii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:mez00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mtc_2502 (pfp)
   01230 Biosynthesis of amino acids
    Mtc_2502 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mtc_2502 (pfp)
   00030 Pentose phosphate pathway
    Mtc_2502 (pfp)
   00051 Fructose and mannose metabolism
    Mtc_2502 (pfp)
   00052 Galactose metabolism
    Mtc_2502 (pfp)
  Energy metabolism
   00680 Methane metabolism
    Mtc_2502 (pfp)
Enzymes [BR:mez01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Mtc_2502 (pfp)
Protein phosphatases and associated proteins [BR:mez01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Mtc_2502 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2373631..2374662
Genome map
AA seq 343 aa AA seqDB search
MIKRIGILTGGGDCPGLNAVIRAVVYKASEYGWEVLGVRYGWKGMLDGDAVPLTKADVKD
ILPLGGTILKTSRTNPYKVEAGEVKVLENAKRMSLDCLVAVGGEDTLGVAYKLTKAGLKC
VGVPKTIDNDLGATDYTFGYQTAVQIATDAMDRLHTTAKSHDRVLVCEVMGRHAGWMTTD
AGMAANAHWIFIPEEKGSVEECCKMLRERYARGERYGIIAVAEGAEFSDLDVKLASQTTD
AFGHVRLGGIAETLAKEIEKRTGFETRHVVLGHTQRGGSPIAYDRILATRLGYKAVEMIK
NGQFGMMSSLRGEKIEAVPIEEAVKALKTVPRQYFEVARTFFG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaggataggcatccttacgggcggcggagactgcccggggctgaacgcggtc
ataagggccgtggtgtataaggcgagcgagtatgggtgggaggtgcttggcgtaaggtat
ggctggaaggggatgcttgatggggacgccgttcctctcacgaaggccgacgttaaggat
attctcccgctgggcgggaccatcctgaagacctcccggacgaacccatataaagtcgag
gccggagaagtgaaggtcctcgagaacgctaaaaggatgagcctggactgcctggtggcg
gtgggcggcgaggacacgctgggagtggcctataagcttactaaggcgggcctaaagtgc
gtcggcgtgcccaagaccatagacaacgacctcggggccaccgactatacctttgggtat
cagactgccgtgcaaatagctaccgacgccatggacaggctgcacaccacggcgaagagc
cacgacagggtgctcgtttgtgaggtcatgggccgccacgctggctggatgaccactgac
gcgggcatggcggcgaacgcccactggatattcatacccgaggagaagggcagcgtggag
gagtgctgtaagatgctcagggaacggtatgcgaggggcgagaggtacggcatcatagcc
gtggcggagggggcggagttcagcgacctggacgtaaagctcgcctcgcagaccacagac
gccttcgggcacgtgaggttgggcggcattgccgagacgctggccaaagagatcgagaag
cgcacgggctttgagacgaggcacgtagtgctggggcatacccagaggggtggctcgccc
atcgcctacgaccgcatcctggccaccaggctgggctataaggccgtcgagatgataaaa
aacgggcagtttggcatgatgtcgagcctgcgaggagaaaagatcgaggccgtgcccatc
gaggaggccgtgaaggcccttaaaaccgtgccccgccagtactttgaggtcgccaggacg
tttttcgggtga

DBGET integrated database retrieval system