KEGG   Methylobacillus flagellatus: Mfla_0034Help
Entry
Mfla_0034         CDS       T00342                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mfa  Methylobacillus flagellatus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mfla_0034
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Mfla_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(33633..34403)
Genome map
AA seq 256 aa AA seqDB search
MVNLTGRHIAITRPLDQATRLTSMIEAAGGHAIGFPLIAIAPLQDYSSFEQTLDEVTMQD
WLIFISSNAVQHAMSRLQAKLPQWPPAKPQFAAIGPVTASQLMQYGITNVLQPEHRFDSE
SLLALPQMQAVKGLRIMIVRGVGGRELMADTLRDRGAEVRFAECYRRINPQADAGKLQSL
WHNGQLDTIVVTSSEAMRNLLAMTGSGTAEWLRDITICVNHARIAELPSSLGLRVLIASA
PGDDAMMQCLSKVNHD
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggttaatttaacaggccgccatattgcaatcacacggccactcgaccaggccacccgc
ttgaccagcatgatcgaagccgctggcgggcatgccatcggctttccgctgattgccatt
gccccgctgcaggattacagcagcttcgagcaaaccctggatgaggtgaccatgcaagac
tggctgatcttcatcagctctaacgctgtccagcatgccatgtcaaggctgcaggcaaaa
ttgccccaatggccgccagccaagccacagttcgccgcaatcgggccggtcactgccagc
cagctgatgcagtatggcatcaccaatgtgctacaacccgagcatcgttttgatagcgaa
tccctgctcgccctgccccaaatgcaggcggtcaagggcctacgcatcatgatcgtgcgc
ggggtcgggggccgcgaactgatggccgataccttgcgtgaccgtggcgccgaagtcagg
tttgcagaatgctatcgacgcatcaacccgcaggcagatgcaggaaaattgcagtcgcta
tggcacaatgggcaactggacaccattgtggtcaccagtagcgaggcaatgcgaaacctg
cttgccatgaccggcagtggcacagcagaatggctgcgtgacatcacaatctgcgtcaac
catgcccgcatcgccgaactgccatccagcctgggcctgcgtgtcctgattgcgtcagca
cctggggatgacgccatgatgcaatgcttaagtaaagtaaaccatgactga

DBGET integrated database retrieval system