KEGG   Methylobacillus flagellatus: Mfla_0039Help
Entry
Mfla_0039         CDS       T00342                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mfa  Methylobacillus flagellatus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(38751..40316)
Genome map
AA seq 521 aa AA seqDB search
MDQHKKSVETARQTLIQLAKSRIAPTPDNYRKVYYAIDGRAATEDSAVAIGRLLSNVLKE
VGIQHPPYGTRINHILNLLETEDWNRLETALLQLLTDLSRHVAPAAATTQDRAGLVTLWR
NMLIRTLDLVVIPQLQEVPDAQARANALLQEAQLAQSREDILALETALKNILFSLEMHLD
TQSQLQLRLLHLLRLLVVSMEALVLEEQWLQGPTAAVREILTQPLNLDSLSKAEDTLKDL
IFMQGQLRPGLIEAKKTLKKMAEIFVAQLAEITLATDDYQSKLNGYRDEISHSDEIQDLN
HVLSRLLEDTQVISSMTQHSRNKIMEAESKVREAEKQIYELTLQLDRINEIAHEDYLTGT
LNRRGMDEALVRELNRADRFGMPLSIAMMDIDHFKQINDNLGHATGDQALAHLASVIKES
LRTTDVIARYGGEEFIILLPGTAEQDAISVIMRAQRELTRKIFLHNDSHILITFSAGVAE
RKAGEPADAIIGRTDQALYRAKNSGRNRVVGASMLDQATEQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacataaaaagtcagttgaaactgcacgacaaacccttattcagcttgccaag
agccggatagcgccaacacccgataattatcgcaaagtctattatgccattgatggccgg
gctgccacggaagatagcgcagtggccataggccggctattgagcaacgtgctcaaggaa
gttggcatacagcatcccccctacggcactcgcatcaaccacatcctcaacctccttgaa
acagaggattggaaccgcctggaaactgcgctgctgcagctgctgacagatttgtccaga
cacgtcgcaccggccgccgccacaacacaagacagggctggcctcgtgacgctctggcgc
aacatgctgatcaggacgctagacctggtagtcataccccaactacaggaagtccccgat
gcccaggcgcgtgcaaacgccttgctgcaagaagcacagctggcgcaaagccgagaagac
atcctggccttggaaaccgcattgaaaaacatcctgtttagcctggaaatgcacttggat
acccagagccagctgcaattacggctgctgcatctgctgcgactgctggtcgtgagcatg
gaggccttggtgctggaagaacaatggcttcagggcccgacggcggcagtgcgcgaaatt
ctgacccagccattgaatctggactcattgtcaaaggctgaggatacgctgaaagacctc
atcttcatgcagggccaattacggccggggctgatcgaggccaagaagacactgaagaaa
atggcagagatattcgtggcacaattggcggaaattaccctggcaacagacgattaccaa
agcaagctgaatggctatcgcgatgaaatcagccatagtgacgaaatacaggacctcaac
catgtattaagccgcctgcttgaagatacccaggtcatcagcagcatgacacaacactcc
cgcaacaagatcatggaggcggaaagcaaagtaagggaagcagaaaagcaaatctacgaa
ctgaccctgcaactagaccgcatcaatgaaatcgcgcatgaggattacctgaccggcacc
ttgaaccgccgcgggatggatgaggcactggtgagggaactcaaccgggctgaccggttc
ggcatgccgctcagcatcgccatgatggatatcgaccatttcaagcagattaatgacaat
cttggccatgccaccggcgaccaggccctggcgcaccttgcctcggtcatcaaggagtcg
ctgcgcacaacggatgtgatcgcacgctatggcggcgaagagttcatcattctcctgccc
ggcactgcggagcaggacgcaatcagtgtcattatgcgcgcgcaacgggagctgacacgg
aaaattttcctgcacaatgacagccatatcctcatcactttcagcgctggtgtcgccgag
cgcaaggcaggtgaaccggccgacgccatcatcggacgtacagaccaggccttgtaccgg
gcaaaaaacagtgggcgcaaccgggtggtgggcgccagcatgcttgatcaggcgacggaa
cagtag

DBGET integrated database retrieval system