KEGG   Methylobacillus flagellatus: Mfla_0039Help
Entry
Mfla_0039         CDS       T00342                                 

Definition
(GenBank) diguanylate cyclase (GGDEF domain)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mfa  Methylobacillus flagellatus
Brite
Enzymes [BR:mfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Mfla_0039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
JGI: 
UniProt: 
Position
complement(38751..40316)
Genome map
AA seq 521 aa AA seqDB search
MDQHKKSVETARQTLIQLAKSRIAPTPDNYRKVYYAIDGRAATEDSAVAIGRLLSNVLKE
VGIQHPPYGTRINHILNLLETEDWNRLETALLQLLTDLSRHVAPAAATTQDRAGLVTLWR
NMLIRTLDLVVIPQLQEVPDAQARANALLQEAQLAQSREDILALETALKNILFSLEMHLD
TQSQLQLRLLHLLRLLVVSMEALVLEEQWLQGPTAAVREILTQPLNLDSLSKAEDTLKDL
IFMQGQLRPGLIEAKKTLKKMAEIFVAQLAEITLATDDYQSKLNGYRDEISHSDEIQDLN
HVLSRLLEDTQVISSMTQHSRNKIMEAESKVREAEKQIYELTLQLDRINEIAHEDYLTGT
LNRRGMDEALVRELNRADRFGMPLSIAMMDIDHFKQINDNLGHATGDQALAHLASVIKES
LRTTDVIARYGGEEFIILLPGTAEQDAISVIMRAQRELTRKIFLHNDSHILITFSAGVAE
RKAGEPADAIIGRTDQALYRAKNSGRNRVVGASMLDQATEQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacataaaaagtcagttgaaactgcacgacaaacccttattcagcttgccaag
agccggatagcgccaacacccgataattatcgcaaagtctattatgccattgatggccgg
gctgccacggaagatagcgcagtggccataggccggctattgagcaacgtgctcaaggaa
gttggcatacagcatcccccctacggcactcgcatcaaccacatcctcaacctccttgaa
acagaggattggaaccgcctggaaactgcgctgctgcagctgctgacagatttgtccaga
cacgtcgcaccggccgccgccacaacacaagacagggctggcctcgtgacgctctggcgc
aacatgctgatcaggacgctagacctggtagtcataccccaactacaggaagtccccgat
gcccaggcgcgtgcaaacgccttgctgcaagaagcacagctggcgcaaagccgagaagac
atcctggccttggaaaccgcattgaaaaacatcctgtttagcctggaaatgcacttggat
acccagagccagctgcaattacggctgctgcatctgctgcgactgctggtcgtgagcatg
gaggccttggtgctggaagaacaatggcttcagggcccgacggcggcagtgcgcgaaatt
ctgacccagccattgaatctggactcattgtcaaaggctgaggatacgctgaaagacctc
atcttcatgcagggccaattacggccggggctgatcgaggccaagaagacactgaagaaa
atggcagagatattcgtggcacaattggcggaaattaccctggcaacagacgattaccaa
agcaagctgaatggctatcgcgatgaaatcagccatagtgacgaaatacaggacctcaac
catgtattaagccgcctgcttgaagatacccaggtcatcagcagcatgacacaacactcc
cgcaacaagatcatggaggcggaaagcaaagtaagggaagcagaaaagcaaatctacgaa
ctgaccctgcaactagaccgcatcaatgaaatcgcgcatgaggattacctgaccggcacc
ttgaaccgccgcgggatggatgaggcactggtgagggaactcaaccgggctgaccggttc
ggcatgccgctcagcatcgccatgatggatatcgaccatttcaagcagattaatgacaat
cttggccatgccaccggcgaccaggccctggcgcaccttgcctcggtcatcaaggagtcg
ctgcgcacaacggatgtgatcgcacgctatggcggcgaagagttcatcattctcctgccc
ggcactgcggagcaggacgcaatcagtgtcattatgcgcgcgcaacgggagctgacacgg
aaaattttcctgcacaatgacagccatatcctcatcactttcagcgctggtgtcgccgag
cgcaaggcaggtgaaccggccgacgccatcatcggacgtacagaccaggccttgtaccgg
gcaaaaaacagtgggcgcaaccgggtggtgggcgccagcatgcttgatcaggcgacggaa
cagtag

DBGET integrated database retrieval system