KEGG   Methylobacillus flagellatus: Mfla_0048Help
Entry
Mfla_0048         CDS       T00342                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00230  Purine metabolism
mfa01100  Metabolic pathways
Module
mfa_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Mfla_0048
Enzymes [BR:mfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Mfla_0048
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_33 AAA_23 AAA_16 AAA_18 cobW RsgA_GTPase AAA_30 ABC_tran MMR_HSR1 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ABE48319
JGI: Mfla0048
UniProt: Q1GXB9
Position
47308..47916
Genome map
AA seq 202 aa AA seqDB search
MKGNLFIITAPSGAGKTSLVRALLDGDEHIKLSVSHTTRKPRPGEEDGVHYHFVEEARFV
ELLNHGDFLESAQVHGAYYGTSQSTVNSALAEGYDLILEIDWQGAQQVRSLYADAISIFI
LPPSMEALEQRLNNRAQDSAEVIARRLAAAREEMRHVTEFDYVTINDRFEHALEDLRAII
RSQRLRREKQLIRYQDVVQKLL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcaatctattcatcatcaccgcgccatcaggcgccgggaaaacctctctggtg
cgcgcattgctagacggtgacgagcatatcaagctctctgtctcccataccacgcgcaag
cctcggcccggcgaggaggacggcgtgcattaccattttgttgaggaggccaggttcgtg
gagctgctcaaccatggtgattttctcgaaagcgcgcaggtgcacggtgcttattacggt
acatcgcagtcgacggtaaattccgcactggcggaaggatatgacctgattctggaaatc
gactggcagggtgcgcagcaggtgcgcagcctatatgccgacgccatcagcatcttcatc
ctaccgccttcgatggaggcgttggaacaacgcttgaacaaccgtgcgcaggatagtgcc
gaagtcattgcgcgcaggcttgctgcagccagggaagagatgcgccacgtgacagaattt
gactatgttacaatcaacgacagattcgaacatgcactggaagacctgcgggccattatc
cgcagccagcggttgcggcgtgaaaagcagctcatccgttatcaggatgtggtgcagaaa
ctgctttag

DBGET integrated database retrieval system