KEGG   Methylobacillus flagellatus: Mfla_0246Help
Entry
Mfla_0246         CDS       T00342                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
mfa  Methylobacillus flagellatus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mfa00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:mfa00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
255871..257142
Genome map
AA seq 423 aa AA seqDB search
MDKLVIQGGVPLHGEISVSGAKNAALPILCAGLLTDGPLTLDNVPQLQDIATMRKLLLHM
GVKIAELGAHCLRLDASDVHTCEAPYDMVKTMRASILVLGPLLARFGHARVSLPGGCAIG
SRPVDLHIKGLQAMGAEIHIDHGYIEAKAAKLKGARVFMDIVTVTGTENLMMAATLADGL
TILENAAKEPEVVDLAECLVKMGAKIEGAGTDVITVTGVASLHAASHDVVCDRIEAGTYM
VATAMTGGEVRLSNARADLLDAVIDKLRESGAEVECSDNSIIVRSKGVVEHPGTLKSVSI
RTAPHPAFPTDMQAQFMALNTVADTVATVTETIFENRFMHVQEMQRLGANIEVEGNTAIV
RGREFLEGATVMATDLRASASLVLAALVARGETVIERIYHLDRGYERLEEKLRQLGARIQ
RIK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
gtggataagctagtcatccagggcggtgtccctttgcacggcgaaatatcggtttccggc
gccaagaacgcagccttgcctattctgtgtgcgggtctgctgacggatggaccactgacg
ctggataatgtgccgcaattgcaggatatcgccaccatgcgcaaattgctgctgcacatg
ggcgtgaagattgctgagttgggagcgcattgtctgcgcctggatgccagcgatgttcat
acctgcgaagcgccgtacgacatggtgaaaacaatgcgtgcctccattcttgtattgggg
ccattgcttgccaggttcggtcatgcgagggtttcattgcctggtggttgtgccatcggc
tcgcgtccggttgacctgcatatcaagggcttgcaggctatgggtgcggagattcatatc
gatcatggctatatcgaggccaaggctgccaagctcaaaggcgcgcgcgtcttcatggat
attgtgaccgtgacgggcacggaaaacctcatgatggctgcaactctcgcagacggcttg
acgatactggaaaacgcagccaaggagcccgaggtggtggatctggcagagtgcctggtc
aaaatgggggcaaagattgagggtgccggtaccgatgtgatcacggtcacgggtgttgcc
agcctgcatgcggctagccatgatgtggtatgtgaccggatcgaagcgggtacttacatg
gtggctactgccatgaccggtggggaagtcagactcagcaatgcacgtgccgacctgctt
gatgcggtgatcgacaagctgcgcgagagtggcgctgaagtcgaatgcagtgacaacagc
atcattgtgcggagcaagggagtggtagagcatcccggtacgctgaaatcggtgagcatc
cgcactgccccacatccggcattccccaccgatatgcaagcccagttcatggcgctgaac
acggtggctgacacagtggcgacggtgacggaaaccattttcgaaaatcgcttcatgcat
gtgcaggaaatgcagcgcctgggcgccaatatcgaggtagaagggaatacggccattgtg
cgcggccgcgagtttctcgaaggggcgaccgtgatggcgactgatttgcgtgcttcggcc
agtttggtactggccgcattggttgcgcgtggtgaaacggtcatcgaacgcatttaccac
ctggaccgtggctatgagcgattggaagaaaagctccggcagctgggcgcgcgcatccag
cggataaagtaa

DBGET integrated database retrieval system