KEGG   Methylobacillus flagellatus: Mfla_0341Help
Entry
Mfla_0341         CDS       T00342                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_0341
Enzymes [BR:mfa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Mfla_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
344410..345321
Genome map
AA seq 303 aa AA seqDB search
MQSVHELNARYGVGHKIHFSADLNGLVTLEIENPHASAKVALQGGHVMQWNPRHAEAPVL
WLSDQARFVAGRSIRGGVPVCWPWFGPHATDETLCPHGFARVVPWDVVDARPEADNTTSL
VLKLVESRQVEKQWPYDCELTLTVNIGPTLKMALTTTNKGHEPFVIGEALHTYFQVSDIE
VVRVLGLDHTEYEDKVEDYALKRQSGDISFNDEVDRVYLNTDSTCVLEDPGLRRKIIIEK
SGSHSTVVWTPWERKAAEIGDLGSHHGWRHMVCVETSNVRGNVVTVEPGSAHTLSVQYST
ESL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcagtacacgaattgaatgcccgatacggggttgggcataaaatccatttttcc
gcagacctgaacggattggtgacgctggaaatcgagaacccacatgcctctgccaaggtc
gccctgcaagggggccatgtcatgcagtggaacccgcgccatgccgaggcgccggtatta
tggttatctgatcaggcgcgtttcgtcgccggacgctctatccggggcggtgtgccggtc
tgctggccgtggtttggcccgcatgccacggacgagacactctgtccccatggctttgcc
cgagtggtgccgtgggacgtggtcgacgctaggccagaggcggacaatacaaccagcctg
gtattgaagctggtggagagtcgccaggtggaaaagcagtggccttacgattgcgagctg
accttgactgtcaatatcggcccgacgctcaaaatggcgttgacgaccaccaataagggt
catgagccgtttgtgatcggcgaggcgttgcatacctatttccaggtcagcgacatcgag
gtcgtcagggtgcttgggctggatcataccgagtacgaggataaggtcgaggattatgcc
ctcaagcgccagtctggagatatcagtttcaatgacgaggtggaccgggtatacctcaat
accgattcgacctgtgtcttggaggatcctggcctgcgccgcaagattatcatcgagaaa
tcaggcagtcattccactgtggtctggacgccatgggagcggaaggcagccgagattggc
gatttgggcagtcatcatggctggcggcatatggtatgtgtcgagacttccaatgtcagg
ggcaatgttgtcaccgtcgagccaggcagtgctcacaccctgagcgtgcagtacagcact
gaaagtttgtag

DBGET integrated database retrieval system