KEGG   Methylobacillus flagellatus: Mfla_0903Help
Entry
Mfla_0903         CDS       T00342                                 

Definition
aminotransferase AlaT (EC:2.6.1.-)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mfa  Methylobacillus flagellatus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Mfla_0903
   01230 Biosynthesis of amino acids
    Mfla_0903
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mfla_0903
   00290 Valine, leucine and isoleucine biosynthesis
    Mfla_0903
Enzymes [BR:mfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Mfla_0903
    2.6.1.66  valine---pyruvate transaminase
     Mfla_0903
Amino acid related enzymes [BR:mfa01007]
 Aminotransferase (transaminase)
  Class I
   Mfla_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
948974..950263
Genome map
AA seq 429 aa AA seqDB search
MQEISKSSKLSNVCYDIRGPVLDRARQMEEDGHRIIKLNIGNPAPFGFAAPEEILQDVIR
NMDSASGYTDSKGLFAARKAIMHYTQQKNIQGVTIDDIIIGNGVSELIVMAMQALLNNGD
QVLVPMPDYPLWTAAVNLAGGTARHYVCDEQTGWLPDLRDIENKITANTRGIVIINPNNP
TGALYPRETLEGIIEIARHHGLVIFADEIYDKVLFDGNTHTSIASLADDVLFVTFNGLSK
NYRTCGYRAGWLVISGEKRHAGDYIEGLNMLASMRLCANVPGQLAIQTALGGYQSIDDLV
APTGRLCKQRDLAYKMLTDIPGVSCVKPKAGLYLFPRLDPKIYPIQDDQQFILDLLLEEK
VLLVQGTGFNWRAPDHFRVVFLPNVDDLTEAFTRIARFLENYRKQHSTITIVEGKASKEA
QTTSQSASA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatttccaagtccagcaagctcagcaacgtatgctacgacattcgtggcccg
gtgctggaccgagcgcggcagatggaggaggacgggcaccgcatcatcaagctcaatatc
ggcaatcctgcgccttttggttttgccgcgcccgaggaaatcctgcaggacgtgattcgc
aacatggattccgcttccggttatacggattccaagggtctgttcgccgcacgtaaggcg
attatgcattacacccagcagaagaatatccagggtgtgaccatcgatgacatcatcatc
ggcaatggcgtttccgagctgatcgtcatggccatgcaggcattgctcaacaacggtgac
caggtactggtgccgatgcctgattatccgttgtggactgcggcagtgaacctggcgggc
gggacggcgcggcactatgtctgcgacgagcagactggctggctacccgacctccgggat
atcgagaacaaaatcacggcgaatacgcgcggcatcgtcattatcaacccgaacaacccg
acgggtgccttgtatccgcgggaaacgctggaaggcatcatcgagatcgcacgccatcac
ggcctggtgattttcgcggacgaaatctacgacaaggtattgttcgacggcaatacgcac
acctcgattgcttcattggctgatgatgtgctgttcgtgaccttcaacggtctgtccaag
aattatcgtacctgcggttaccgcgccggttggctggtgatctcgggagagaagcggcat
gcgggagactacatcgaggggttgaacatgctggcttcgatgcgcctgtgcgccaatgtg
cccgggcagttggcgatccagaccgcgctgggcggctaccagagcatagacgaccttgtg
gcgccgaccggccggttatgcaagcagcgcgaccttgcctacaagatgctgaccgatatt
cctggtgtaagttgcgtcaagcccaaggctggcctgtacctgtttccgcgccttgatccc
aaaatatatcccatccaggatgaccagcaattcatcctcgacctgttgctggaggagaaa
gtcctgctggtgcagggcacgggcttcaactggcgcgcgccggatcatttccgcgtcgtg
ttcctgccgaatgtggatgacctcaccgaggcatttacccgaattgcccgcttcctggaa
aattaccgcaagcagcacagcaccatcaccatagtggaaggcaaagcctcgaaagaggca
caaacaacctcccaaagcgcgtcggcatga

DBGET integrated database retrieval system