KEGG   Methylobacillus flagellatus: Mfla_0903Help
Entry
Mfla_0903         CDS       T00342                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00220  Arginine biosynthesis
mfa00250  Alanine, aspartate and glutamate metabolism
mfa00290  Valine, leucine and isoleucine biosynthesis
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01130  Biosynthesis of antibiotics
mfa01210  2-Oxocarboxylic acid metabolism
mfa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mfla_0903
   00290 Valine, leucine and isoleucine biosynthesis
    Mfla_0903
   00220 Arginine biosynthesis
    Mfla_0903
Enzymes [BR:mfa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Mfla_0903
    2.6.1.66  valine---pyruvate transaminase
     Mfla_0903
Amino acid related enzymes [BR:mfa01007]
 Aminotransferase (transaminase)
  Class I
   Mfla_0903
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ABE49171
JGI: Mfla0903
UniProt: Q1H2H2
Position
948974..950263
Genome map
AA seq 429 aa AA seqDB search
MQEISKSSKLSNVCYDIRGPVLDRARQMEEDGHRIIKLNIGNPAPFGFAAPEEILQDVIR
NMDSASGYTDSKGLFAARKAIMHYTQQKNIQGVTIDDIIIGNGVSELIVMAMQALLNNGD
QVLVPMPDYPLWTAAVNLAGGTARHYVCDEQTGWLPDLRDIENKITANTRGIVIINPNNP
TGALYPRETLEGIIEIARHHGLVIFADEIYDKVLFDGNTHTSIASLADDVLFVTFNGLSK
NYRTCGYRAGWLVISGEKRHAGDYIEGLNMLASMRLCANVPGQLAIQTALGGYQSIDDLV
APTGRLCKQRDLAYKMLTDIPGVSCVKPKAGLYLFPRLDPKIYPIQDDQQFILDLLLEEK
VLLVQGTGFNWRAPDHFRVVFLPNVDDLTEAFTRIARFLENYRKQHSTITIVEGKASKEA
QTTSQSASA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcaagaaatttccaagtccagcaagctcagcaacgtatgctacgacattcgtggcccg
gtgctggaccgagcgcggcagatggaggaggacgggcaccgcatcatcaagctcaatatc
ggcaatcctgcgccttttggttttgccgcgcccgaggaaatcctgcaggacgtgattcgc
aacatggattccgcttccggttatacggattccaagggtctgttcgccgcacgtaaggcg
attatgcattacacccagcagaagaatatccagggtgtgaccatcgatgacatcatcatc
ggcaatggcgtttccgagctgatcgtcatggccatgcaggcattgctcaacaacggtgac
caggtactggtgccgatgcctgattatccgttgtggactgcggcagtgaacctggcgggc
gggacggcgcggcactatgtctgcgacgagcagactggctggctacccgacctccgggat
atcgagaacaaaatcacggcgaatacgcgcggcatcgtcattatcaacccgaacaacccg
acgggtgccttgtatccgcgggaaacgctggaaggcatcatcgagatcgcacgccatcac
ggcctggtgattttcgcggacgaaatctacgacaaggtattgttcgacggcaatacgcac
acctcgattgcttcattggctgatgatgtgctgttcgtgaccttcaacggtctgtccaag
aattatcgtacctgcggttaccgcgccggttggctggtgatctcgggagagaagcggcat
gcgggagactacatcgaggggttgaacatgctggcttcgatgcgcctgtgcgccaatgtg
cccgggcagttggcgatccagaccgcgctgggcggctaccagagcatagacgaccttgtg
gcgccgaccggccggttatgcaagcagcgcgaccttgcctacaagatgctgaccgatatt
cctggtgtaagttgcgtcaagcccaaggctggcctgtacctgtttccgcgccttgatccc
aaaatatatcccatccaggatgaccagcaattcatcctcgacctgttgctggaggagaaa
gtcctgctggtgcagggcacgggcttcaactggcgcgcgccggatcatttccgcgtcgtg
ttcctgccgaatgtggatgacctcaccgaggcatttacccgaattgcccgcttcctggaa
aattaccgcaagcagcacagcaccatcaccatagtggaaggcaaagcctcgaaagaggca
caaacaacctcccaaagcgcgtcggcatga

DBGET integrated database retrieval system