KEGG   Methylobacillus flagellatus: Mfla_0905Help
Entry
Mfla_0905         CDS       T00342                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfla_0905
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfla_0905
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mfla_0905
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mfla_0905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
951679..953106
Genome map
AA seq 475 aa AA seqDB search
MRYISTRGQSPAQSFTEILLGGLAPDGGLYLPEQYPQFSQDELNAMRGMHYRDLAFTILS
RLIDDIPAADLRAIIDKTYRADVYAYARAGQNAEDITPTLKLEDDLYLLSLSNGPTLAFK
DMAMQLLGNLFEYVLAQKGETINILGATSGDTGSAAEYAMRGKQGVKVFMLSPYQKMSRF
QTAQMFSLQDDNIFNIAVKGVFDDCQDIVKAVSNDHAFKAKNKIGAVNSINWARVAAQVV
YYFKGYFAVTADNAQRVSFAVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDVLDEFFK
TGVYRPRGSANTYHTSSPSMDISKASNFERFVFDLVGRDAAKVRELWGKVDAGGSVDLNE
GGWFAKVADYGFVSGSSNHANRMQTIRVTHERYGVTIDTHTADGLKVALEQREAGIPMLV
LETALPAKFEDAIVEALGQKPERPHSLEGLEALPQRFEVMEADVAAIKQFIVEHV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagatatatttccacccgcgggcaatcgcccgcacagtcgtttactgaaatcctgctt
ggcggcctggcgcccgatggcggcctctatttgcccgagcaatatccgcaattcagccag
gacgagctgaatgcgatgcgcggcatgcattaccgcgacctggcgttcaccatcctctcg
cgcctgatcgatgatattcctgctgctgacctgcgcgccattatcgacaagacctatcgt
gcggatgtctatgcctatgcgcgcgctggacagaatgccgaggacatcactcccacgctc
aagctggaggacgacctctacctgctgtccttgtccaatggcccgaccctggcattcaag
gacatggcgatgcagttgcttggcaacctgttcgaatatgtgctggcgcagaaaggcgag
acgatcaatatcctcggcgcaacttccggagacaccggttctgctgcggaatacgccatg
cgcggcaagcagggtgtcaaggtgttcatgctctcgccttaccagaagatgagccgtttc
cagactgcgcagatgttcagcctgcaggatgacaatattttcaatatcgcggtcaagggc
gtgttcgacgattgccaggacatcgtcaaggccgtgtccaatgaccatgccttcaaggca
aagaacaagatcggcgcagtaaactccatcaactgggcgcgtgtggcggcccaggtggtg
tattacttcaagggttactttgccgtcaccgcggacaatgcgcagcgggtcagcttcgcc
gtgccttccggcaacttcggcaacgtctgtgccgggcatatcgcccgcatgatgggcttg
ccgattgccaagctggtagtggcgaccaacgaaaacgatgtgctggacgaattcttcaag
accggtgtctatcgtccgcgcggttctgccaatacttaccacacctccagtccttccatg
gatatttccaaggcatccaatttcgagcgcttcgtcttcgatctggtgggccgtgatgcg
gccaaggtgcgtgagctgtggggcaaggtagatgcgggtggcagcgtcgacctcaatgaa
ggcggttggtttgccaaggtggcggattacggctttgtctccggcagcagcaaccacgcc
aaccgcatgcagaccatcagggtgacccatgagcgctatggcgtcaccatcgatacccat
accgccgatggtctcaaggtggcgttggagcagcgcgaggcgggcattccgatgctggta
cttgaaaccgcgttgccggccaaattcgaggatgcgattgtcgaggcgctgggccagaag
cccgaacgcccgcacagcctggagggcttggaagccctgccgcagcgctttgaggtgatg
gaggccgatgtggccgctatcaagcagttcattgtcgagcatgtttga

DBGET integrated database retrieval system