KEGG   Methylobacillus flagellatus: Mfla_1049Help
Entry
Mfla_1049         CDS       T00342                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfla_1049
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfla_1049
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mfla_1049
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mfla_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1094711..1096138
Genome map
AA seq 475 aa AA seqDB search
MRYISTRGQSPAQSFTEILLGGLAPDGGLYLPEQYPQFSQDELNAMRGMHYRDLAFTILS
RLIDDIPAADLRAIIDKTYRADVYAYARAGQNAEDITPTLKLEDDLYLLSLSNGPTLAFK
DMAMQLLGNLFEYVLAQKGETINILGATSGDTGSAAEYAMRGKQGVKVFMLSPYQKMSRF
QTAQMFSLQDDNIFNIAVKGVFDDCQDIVKAVSNDHAFKAKNKIGAVNSINWARVAAQVV
YYFKGYFAVTADNAQRVSFAVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDVLDEFFK
TGVYRPRGSANTYHTSSPSMDISKASNFERFVFDLVGRDAAKVRELWGKVDAGGSVDLNE
GGWFAKVADYGFVSGSSNHANRMQTIRVTHERYGVTIDTHTADGLKVALEQREAGIPMLV
LETALPAKFEDAIVEALGQKPERPHSLEGLEALPQRFEVMEADVAAIKQFIVEHV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagatatatttccacccgcgggcaatcgcccgcacagtcgtttactgaaatcctgctt
ggcggcctggcgcccgatggcggcctctatttgcccgagcaatatccgcaattcagccag
gacgagctgaatgcgatgcgcggcatgcattaccgcgacctggcgttcaccatcctctcg
cgcctgatcgatgatattcctgctgctgacctgcgcgccattatcgacaagacctatcgt
gcggatgtctatgcctatgcgcgcgctggacagaatgccgaggacatcactcccacgctc
aagctggaggacgacctctacctgctgtccttgtccaatggcccgaccctggcattcaag
gacatggcgatgcagttgcttggcaacctgttcgaatatgtgctggcgcagaaaggcgag
acgatcaatatcctcggcgcaacttccggagacaccggttctgctgcggaatacgccatg
cgcggcaagcagggtgtcaaggtgttcatgctctcgccttaccagaagatgagccgtttc
cagactgcgcagatgttcagcctgcaggatgacaatattttcaatatcgcggtcaagggc
gtgttcgacgattgccaggacatcgtcaaggccgtgtccaatgaccatgccttcaaggca
aagaacaagatcggcgcagtaaactccatcaactgggcgcgtgtggcggcccaggtggtg
tattacttcaagggttactttgccgtcaccgcggacaatgcgcagcgggtcagcttcgcc
gtgccttccggcaacttcggcaacgtctgtgccgggcatatcgcccgcatgatgggcttg
ccgattgccaagctggtagtggcgaccaacgaaaacgatgtgctggacgaattcttcaag
accggtgtctatcgtccgcgcggttctgccaatacttaccacacctccagtccttccatg
gatatttccaaggcatccaatttcgagcgcttcgtcttcgatctggtgggccgtgatgcg
gccaaggtgcgtgagctgtggggcaaggtagatgcgggtggcagcgtcgacctcaatgaa
ggcggttggtttgccaaggtggcggattacggctttgtctccggcagcagcaaccacgcc
aaccgcatgcagaccatcagggtgacccatgagcgctatggcgtcaccatcgatacccat
accgccgatggtctcaaggtggcgttggagcagcgcgaggcgggcattccgatgctggta
cttgaaaccgcgttgccggccaaattcgaggatgcgattgtcgaggcgctgggccagaag
cccgaacgcccgcacagcctggagggcttggaagccctgccgcagcgctttgaggtgatg
gaggccgatgtggccgctatcaagcagttcattgtcgagcatgtttga

DBGET integrated database retrieval system