KEGG   Methylobacillus flagellatus: Mfla_1049Help
Entry
Mfla_1049         CDS       T00342                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00260  Glycine, serine and threonine metabolism
mfa00750  Vitamin B6 metabolism
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01120  Microbial metabolism in diverse environments
mfa01230  Biosynthesis of amino acids
Module
mfa_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfla_1049
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mfla_1049
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mfla_1049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ABE49317
JGI: Mfla1049
UniProt: Q1H2H0
Position
1094711..1096138
Genome map
AA seq 475 aa AA seqDB search
MRYISTRGQSPAQSFTEILLGGLAPDGGLYLPEQYPQFSQDELNAMRGMHYRDLAFTILS
RLIDDIPAADLRAIIDKTYRADVYAYARAGQNAEDITPTLKLEDDLYLLSLSNGPTLAFK
DMAMQLLGNLFEYVLAQKGETINILGATSGDTGSAAEYAMRGKQGVKVFMLSPYQKMSRF
QTAQMFSLQDDNIFNIAVKGVFDDCQDIVKAVSNDHAFKAKNKIGAVNSINWARVAAQVV
YYFKGYFAVTADNAQRVSFAVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDVLDEFFK
TGVYRPRGSANTYHTSSPSMDISKASNFERFVFDLVGRDAAKVRELWGKVDAGGSVDLNE
GGWFAKVADYGFVSGSSNHANRMQTIRVTHERYGVTIDTHTADGLKVALEQREAGIPMLV
LETALPAKFEDAIVEALGQKPERPHSLEGLEALPQRFEVMEADVAAIKQFIVEHV
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgagatatatttccacccgcgggcaatcgcccgcacagtcgtttactgaaatcctgctt
ggcggcctggcgcccgatggcggcctctatttgcccgagcaatatccgcaattcagccag
gacgagctgaatgcgatgcgcggcatgcattaccgcgacctggcgttcaccatcctctcg
cgcctgatcgatgatattcctgctgctgacctgcgcgccattatcgacaagacctatcgt
gcggatgtctatgcctatgcgcgcgctggacagaatgccgaggacatcactcccacgctc
aagctggaggacgacctctacctgctgtccttgtccaatggcccgaccctggcattcaag
gacatggcgatgcagttgcttggcaacctgttcgaatatgtgctggcgcagaaaggcgag
acgatcaatatcctcggcgcaacttccggagacaccggttctgctgcggaatacgccatg
cgcggcaagcagggtgtcaaggtgttcatgctctcgccttaccagaagatgagccgtttc
cagactgcgcagatgttcagcctgcaggatgacaatattttcaatatcgcggtcaagggc
gtgttcgacgattgccaggacatcgtcaaggccgtgtccaatgaccatgccttcaaggca
aagaacaagatcggcgcagtaaactccatcaactgggcgcgtgtggcggcccaggtggtg
tattacttcaagggttactttgccgtcaccgcggacaatgcgcagcgggtcagcttcgcc
gtgccttccggcaacttcggcaacgtctgtgccgggcatatcgcccgcatgatgggcttg
ccgattgccaagctggtagtggcgaccaacgaaaacgatgtgctggacgaattcttcaag
accggtgtctatcgtccgcgcggttctgccaatacttaccacacctccagtccttccatg
gatatttccaaggcatccaatttcgagcgcttcgtcttcgatctggtgggccgtgatgcg
gccaaggtgcgtgagctgtggggcaaggtagatgcgggtggcagcgtcgacctcaatgaa
ggcggttggtttgccaaggtggcggattacggctttgtctccggcagcagcaaccacgcc
aaccgcatgcagaccatcagggtgacccatgagcgctatggcgtcaccatcgatacccat
accgccgatggtctcaaggtggcgttggagcagcgcgaggcgggcattccgatgctggta
cttgaaaccgcgttgccggccaaattcgaggatgcgattgtcgaggcgctgggccagaag
cccgaacgcccgcacagcctggagggcttggaagccctgccgcagcgctttgaggtgatg
gaggccgatgtggccgctatcaagcagttcattgtcgagcatgtttga

DBGET integrated database retrieval system