KEGG   Methylobacillus flagellatus: Mfla_1279Help
Entry
Mfla_1279         CDS       T00342                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfa  Methylobacillus flagellatus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mfla_1279
   00052 Galactose metabolism
    Mfla_1279
   00500 Starch and sucrose metabolism
    Mfla_1279
   00520 Amino sugar and nucleotide sugar metabolism
    Mfla_1279
Enzymes [BR:mfa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mfla_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1357132..1358007
Genome map
AA seq 291 aa AA seqDB search
MAKKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAAEEAVAAGATELIFIIGR
NKRTIPDHFDKSFELEATLEASKKTKVLEEIRNILPKNVSCIYIRQAEALGLGHAVLLAK
SVVGSEPFSVILADDLIDADKPAMQQMTELFDQEGVSILGVEDVEPSETASYGIVDATEV
SGPNVLQLNGIVEKPQPEEAPSNLAVVGRYILTPEIFECLENVKPGKGGEIQLTDGIAAL
MEKQKILAYRFDGKRYDCGSKLGYVKANVEYSLKHEEFGKEFAQYLRDLTK
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaattaccaaggcagtatttccagtggcaggtttagggacacgtttcctg
ccagcaaccaaggcgagtcccaaggaaatgttgccaattgtggataagcctctgattcag
tatgcagcagaggaggctgtggccgccggtgctaccgagctgatttttattatcgggcgc
aacaagcgcaccatcccggatcattttgataagtccttcgagctggaagcgacgcttgag
gcaagcaagaaaaccaaggtgctggaagaaatccgcaatatcctgccaaaaaatgtttcc
tgcatctatattcgccaggccgaggcgcttggtttggggcatgcggtattgcttgccaag
tccgtggtcggcagcgagcctttctctgtgatcctggccgatgaccttattgatgccgac
aaacctgccatgcagcagatgacagagctgttcgaccaagagggtgtcagcattctgggt
gtcgaggatgtggagcccagtgagacggcaagctatggcattgtggatgcgacagaggtg
agtggcccgaatgtgttgcaattgaatggcattgtggaaaaaccgcagccggaagaagcg
ccctccaatctggctgttgtcggtcggtatattctcacgcctgaaatttttgaatgcctg
gagaacgtcaagccgggcaagggcggggaaatccagttgactgatggcattgccgccttg
atggaaaaacagaaaatcctggcttaccgtttcgatgggaagcgctacgattgcggcagc
aagctgggttatgtcaaggcgaacgtcgagtattccttgaagcatgaggagtttggcaaa
gagtttgcccagtacttacgtgatctaaccaagtag

DBGET integrated database retrieval system