KEGG   Methylobacillus flagellatus: Mfla_1327Help
Entry
Mfla_1327         CDS       T00342                                 

Definition
single-strand binding protein/primosomal replication protein n
Orthology
K02686  
primosomal replication protein N
Organism
mfa  Methylobacillus flagellatus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mfa03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1410298..1410597
Genome map
AA seq 99 aa AA seqDB search
MSLNRLELDGEFTQLAELRYTPAGIPVSSFVLKHVSEQVEAGMKRKVECDVSSMAMGPLA
LEAQNISEGSSVKVTGFLAKRSLKSSQLVLHIQTLERII
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
gtgagcttgaacaggctggagttggacggcgagttcacgcaattggcggaactgcgctac
accccggcaggaataccagtatcgagcttcgtcctgaagcatgtgtctgaacaggtcgag
gcgggaatgaagcgcaaggttgaatgcgacgtgtcaagcatggcgatggggccactggca
ctggaagcgcaaaacatcagcgaggggtcgagtgtgaaagtgaccgggtttctcgcaaag
cgcagcctcaagagttcgcagctggtattgcatatacaaacattggaaagaattatctga

DBGET integrated database retrieval system