KEGG   Methylobacillus flagellatus: Mfla_1524Help
Entry
Mfla_1524         CDS       T00342                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00900  Terpenoid backbone biosynthesis
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mfla_1524
Enzymes [BR:mfa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Mfla_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh NmrA
Motif
Other DBs
NCBI-ProteinID: ABE49792
JGI: Mfla1524
UniProt: Q1H145
Position
complement(1629384..1630568)
Genome map
AA seq 394 aa AA seqDB search
MPMLQNVTILGATGTIGLNTLDVISRHPGRYRVFALTANSRVDELAELCLQHRPRYAVML
DSGAAEKLQQKLKGLETQVLSGLAALEEVAAHPEAHVVMAAIVGAAGLKPAMAAAYAGKR
ILLANKETLVMAGKLFMQAVEEGGATLLPIDSEHNAIFQVMPPARLSALADGGIRRILLT
ASGGPFRKSSFAELMAVTPAQALNHPNWVMGPKITIDSATLMNKGLEVIEAHWLFNAPAD
KIEVVVHPQSVIHSMVEYIDGSVLAQMGNPDMRTPIAYGLGYPERLKAGVNALDLFKVGR
LDFEAPDTARFPCLRLAFDALRHGGTAPAILNAANEVAVDAFLNGNIGFQDIPRLIEAVL
TAMDIEAVTSISQLIEVDALARAHALEWRQLEAC
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcccatgttgcaaaatgtcaccattctgggcgcgaccggtacgataggcctcaacact
ctggatgtgatctccaggcatccggggcgataccgtgtgtttgccctgaccgctaattcc
cgcgttgatgagcttgctgagctgtgcctgcagcatcggccccggtatgccgtcatgctg
gacagcggcgccgcagaaaaactgcagcaaaagctgaaaggcttggaaacccaagtgctt
tcgggcttggcagcgctggaagaggtcgcagctcacccggaggcccatgtggtcatggcc
gccatcgtcggcgcagcagggctcaagccagccatggcggcggcatacgccggcaagcgg
attctgctcgccaacaaggaaaccttggtcatggcgggtaagctgttcatgcaggcagtg
gaagagggcggcgctaccttgctgcctattgatagcgagcacaatgcaattttccaggtc
atgcctccagcgcgattatcagcccttgcggatggcggcatcaggcgcattctgctgacc
gcctcgggcgggcctttccgcaaatcaagcttcgctgagctgatggcggtgacgccagca
caggcattgaaccaccctaactgggtcatgggccccaagatcaccattgattccgccacc
ctcatgaataaagggctcgaggtcattgaggcgcactggctgttcaatgcgccggcagac
aagattgaggtcgtggtgcatccgcaaagcgtgattcattccatggtggaatatatagat
ggctccgttctggcccagatggggaaccccgacatgcgcaccccgattgcctatggcttg
gggtacccagaaagactcaaggcgggggtcaatgcacttgatttgttcaaggtcggcagg
ctggatttcgaagcgcccgatactgcacgtttcccatgcttgcggctggccttcgatgcc
ttacgccatggcggcacggcgcccgctattctgaatgccgcgaacgaagtggcagtggat
gcttttctgaatggcaacatcggtttccaggacattcctcgcctgatagaggctgtgttg
acagccatggatattgaggccgtcacatccatttcacaattgattgaggtcgacgccttg
gcgcgtgctcatgccctggagtggaggcaattggaagcatgctga

DBGET integrated database retrieval system