KEGG   Methylobacillus flagellatus: Mfla_1697Help
Entry
Mfla_1697         CDS       T00342                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfla_1697
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfla_1697
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfla_1697
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfla_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
JGI: 
UniProt: 
Position
complement(1815629..1816435)
Genome map
AA seq 268 aa AA seqDB search
MSRIQATFATLKSQGKKALIPYITAGDPHPKHTVALMHALVQAGSDIIELGVPFSDPMAD
GPVIQCATERALAHKVGLINVLEMVREFRRVDDRTPVVLMGYANPIEAMGQAKFAERACA
AGVDGVLTVDYPPEECQDFVQLLKSQQLDPIFLLSPTSDSSRVDMIVHQAAGFVYYVSLK
GVTGSQNIDIAEVGTRVKAIRSRTDLPVGVGFGVRDAATAKAVAEIADAVVIGSRMIQEI
ENSSEDALLSNVAALTQSMRTAIDDAKT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtatccaagcaacatttgcgacgctcaagtcgcaaggcaagaaagccctgatc
ccgtatatcacggcaggtgatccccatcccaagcataccgtagcgttgatgcatgcactg
gtgcaagccggctcagacattatcgagctgggtgtgccattttccgatcccatggcggac
ggcccggtaattcagtgcgccaccgagcgtgccctggcccacaaggttggcttgatcaac
gtgctggagatggtgcgtgaattccgccgtgtcgatgacaggactcctgttgtgctgatg
ggatatgccaaccctatagaagcgatggggcaagcaaagtttgccgagcgtgcctgtgca
gcaggtgtggatggtgtgctgacagtcgattacccaccagaggaatgccaggattttgtg
cagctgctgaaatcgcagcagctggatcccatattcctgctgtcgcctacgtcggacagt
agccgtgtcgatatgatcgtgcatcaggcagcaggttttgtctattatgtttcactcaaa
ggtgtcaccggctctcagaatattgatattgccgaggtcggtaccagggtgaaggcgata
cgcagccgcacagatctacctgtaggcgtcggttttggcgtgagggatgcggccacggca
aaggcagtggctgagatagcggatgccgtggtgatcggaagtcgcatgattcaggaaatt
gaaaactccagcgaagacgcattgctgagtaatgtagcggcattgacgcagagcatgcgt
acggcaattgacgatgccaagacttaa

DBGET integrated database retrieval system