KEGG   Methylobacillus flagellatus: Mfla_1697Help
Entry
Mfla_1697         CDS       T00342                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00260  Glycine, serine and threonine metabolism
mfa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01130  Biosynthesis of antibiotics
mfa01230  Biosynthesis of amino acids
Module
mfa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfla_1697
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfla_1697
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfla_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB Lys-AminoMut_A
Motif
Other DBs
NCBI-ProteinID: ABE49965
JGI: Mfla1697
UniProt: Q1H0M2
Position
complement(1815629..1816435)
Genome map
AA seq 268 aa AA seqDB search
MSRIQATFATLKSQGKKALIPYITAGDPHPKHTVALMHALVQAGSDIIELGVPFSDPMAD
GPVIQCATERALAHKVGLINVLEMVREFRRVDDRTPVVLMGYANPIEAMGQAKFAERACA
AGVDGVLTVDYPPEECQDFVQLLKSQQLDPIFLLSPTSDSSRVDMIVHQAAGFVYYVSLK
GVTGSQNIDIAEVGTRVKAIRSRTDLPVGVGFGVRDAATAKAVAEIADAVVIGSRMIQEI
ENSSEDALLSNVAALTQSMRTAIDDAKT
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtatccaagcaacatttgcgacgctcaagtcgcaaggcaagaaagccctgatc
ccgtatatcacggcaggtgatccccatcccaagcataccgtagcgttgatgcatgcactg
gtgcaagccggctcagacattatcgagctgggtgtgccattttccgatcccatggcggac
ggcccggtaattcagtgcgccaccgagcgtgccctggcccacaaggttggcttgatcaac
gtgctggagatggtgcgtgaattccgccgtgtcgatgacaggactcctgttgtgctgatg
ggatatgccaaccctatagaagcgatggggcaagcaaagtttgccgagcgtgcctgtgca
gcaggtgtggatggtgtgctgacagtcgattacccaccagaggaatgccaggattttgtg
cagctgctgaaatcgcagcagctggatcccatattcctgctgtcgcctacgtcggacagt
agccgtgtcgatatgatcgtgcatcaggcagcaggttttgtctattatgtttcactcaaa
ggtgtcaccggctctcagaatattgatattgccgaggtcggtaccagggtgaaggcgata
cgcagccgcacagatctacctgtaggcgtcggttttggcgtgagggatgcggccacggca
aaggcagtggctgagatagcggatgccgtggtgatcggaagtcgcatgattcaggaaatt
gaaaactccagcgaagacgcattgctgagtaatgtagcggcattgacgcagagcatgcgt
acggcaattgacgatgccaagacttaa

DBGET integrated database retrieval system