KEGG   Methylobacillus flagellatus: Mfla_1698Help
Entry
Mfla_1698         CDS       T00342                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mfla_1698
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mfla_1698
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mfla_1698
Enzymes [BR:mfa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mfla_1698
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
JGI: 
UniProt: 
Position
complement(1816449..1817651)
Genome map
AA seq 400 aa AA seqDB search
MQLYDMPDKRGHFGPYGGIFVAETLVEALEELRVMYERYRHDPDFLAEFAYDLKHFVGRP
SPVYYAERLTQKAGGARIYLKREDLNHTGAHKVNNTIGQALLAKRMGKPRVIAETGAGQH
GVATATIAARLGLECVVYMGAEDVKRQAPNVFRMKLLGATVVPVESGSKTLKDALNEAMR
DWVTNISNTFYIIGTVAGPHPYPMMVRDFQAVIGTEAKQQMQELIGRQPDAVIACVGGGS
NAMGIFYPYIDVEGVRLIGVEAAGHGIDTGRHAAPLTANSPAGVLHGNRTYLMQDENGQI
IETHSISAGLDYPGVGPEHAWLKDIKRAEYVAVTDDEAMEAFHTLCRTEGIIPALESSHA
LAYAMKLAETMSPDQALLVNLSGRGDKDINTVASLAGITL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcagctttatgatatgccggataagcgtggccattttggtccttatggcggtattttt
gtagccgagacgttggtcgaggcgttggaagagttgcgtgtcatgtatgaacgctatcgc
cacgaccctgacttccttgccgagtttgcttatgacttaaagcattttgtcgggcgtccc
agcccggtatattatgccgagcgcctcacgcagaaagcaggtggtgctaggatttatctc
aagcgtgaagatttgaatcatacaggcgcgcacaaggtgaacaatacgattggtcaggca
ttgcttgccaagcgcatgggcaagccgcgcgtgatcgccgagaccggcgcgggccagcat
ggcgtggcgactgccacgattgctgcccgtcttggtctggagtgcgtggtgtatatgggc
gccgaggatgtcaagcgtcaggcaccgaatgtattccgcatgaagttgctgggcgccaca
gtggtgccggtggagagcggttccaagacgctcaaggacgcgctcaatgaagcaatgcgg
gactgggtcaccaatatatcgaatactttctacatcatcggtacggtggctgggccgcac
ccttacccgatgatggtgcgcgatttccaggcagtgattggcacagaagccaagcagcag
atgcaggagttgatcggccgtcagcccgatgcagtgatcgcctgtgtcggcggtggctcc
aatgccatgggtattttctacccttatatcgacgtagaaggcgtgcgcctgatcggtgtc
gaagcagcagggcatggcatcgacaccggcaggcatgccgcgcctttgacagccaacagt
cctgccggcgttctgcacggcaaccgcacttacttaatgcaggacgagaacgggcagatc
attgaaacacattccatttctgccgggctggactatcctggcgttggccctgagcatgca
tggctcaaggatatcaagcgtgccgaatacgtggcggtcacggatgacgaggccatggaa
gcattccataccctgtgtcgtaccgaaggcatcattccggcgctggagtccagccatgca
ttggcgtatgcgatgaagctcgccgagaccatgtcgcctgaccaagcgttgctggtcaac
ttgtccggacgcggcgacaaggatatcaataccgtcgccagcctggctggcatcaccctg
taa

DBGET integrated database retrieval system