KEGG   Methylobacillus flagellatus: Mfla_1727Help
Entry
Mfla_1727         CDS       T00342                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfla_1727
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_1727
   00620 Pyruvate metabolism
    Mfla_1727
   00640 Propanoate metabolism
    Mfla_1727
  Energy metabolism
   00680 Methane metabolism
    Mfla_1727
Enzymes [BR:mfa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mfla_1727
Lipid biosynthesis proteins [BR:mfa01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mfla_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1850682..1852646
Genome map
AA seq 654 aa AA seqDB search
MSSIESVLTETRVFAPHETFRQAATVSGLPGYQALCDAAEQDYTGFWANLARQEISWQTP
FTEVLDESNAPFYRWFADGKLNASYNCIDRHLEKRANKIALIFEADNGDVANITYRELHQ
RVCRFANALKKQGVGLGDRVIIYLPMSIEAIVAMQACARIGAIHSVVFGGFSAKSLHERI
VDVGAKLVITADAGIRGGKQVALKASVDEALELGGCESVEKVIVYQRTGVDIAWNPHRDA
WWHEVEAAENDNCEPVWVDAEHPLFILYTSGSTGTPKGVQHSTGGYLLGAIMSMKWVFDH
KATDIFWCTADVGWITGHSYVAYGPLALGSTQVVFEGVPTYPDAGRFWQMIERHKVSIFY
TAPTAIRSLIKLGGDLPHKYDLSSLRLLGTVGEPINPEAWMWYYKVVGKERCPIADTWWQ
TETGAHMIAPLPGAIDLKPGSCTRPLPGIIMDIVEEDGTHIEGTGGGLLVVKKPWPSMIR
NIWGNPERFRKAYFPEELNGLYLAGDSAHRDEDGYFWIMGRIDDVLNVSGHRLGTMEIES
ALVANPLVAEAAIVGKPHDIKGESIVAYVVLKGERPEGEAAKTIAGQLREWVGKEIGPIA
KPDEIRFGENLPKTRSGKIMRRLLRSLAKGEEITSDISTLDNPAILDQLRQSAG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccattgaatccgtgctgacggaaacgcgcgtttttgcgccgcatgaaacattc
cgccaggccgccaccgtctcgggattgcctggctaccaggctttatgcgatgcggctgag
caggattacaccggcttttgggccaaccttgcccggcaggaaatctcgtggcagaccccg
ttcaccgaggtactggatgagtcgaatgcccctttctatcgctggtttgccgatggcaaa
ctcaatgcttcctataactgtatagaccgtcacctggaaaaacgggccaacaagatcgcg
ctgatttttgaggccgataacggcgatgtcgccaacattacctatagggaacttcaccag
cgcgtatgccgcttcgccaatgctttgaaaaagcaaggggtcggcctcggcgaccgcgtc
atcatctacctgcccatgagcatagaagccatcgttgccatgcaggcctgtgcccgcatc
ggggcaatccactccgtggtattcggcggcttttccgccaagagcctgcacgagcgcatc
gtcgatgtcggcgccaagctggtcatcactgccgacgccggtatacgcggaggcaaacag
gtagcattgaaggcttcagtggacgaagcgctggagctgggcggctgcgaatcggtcgag
aaagtcatcgtctaccagcgtacaggcgtggatattgcctggaatccgcaccgcgacgca
tggtggcatgaggttgaagccgccgagaacgacaattgcgagcctgtctgggtggatgcc
gaacatcctctgttcattctatacacttcgggctccaccggcacgccgaaaggcgtacag
cattccaccggaggctatctgcttggcgccatcatgagcatgaaatgggtgttcgaccat
aaagccaccgatattttctggtgtacggccgacgttggctggatcaccggccacagctac
gtagcttacggcccattggcgctcggcagtacgcaagtggtgttcgagggcgtgccaact
tatcccgacgccggccgcttctggcaaatgatagaacgccacaaggtcagcattttctac
accgcacccactgccatccgttcgctgatcaagctgggcggcgacctaccccacaagtat
gacctctcgagcctgaggctactgggcaccgtgggtgagccgatcaaccctgaagcctgg
atgtggtattacaaagtggtcggcaaggagcgctgcccgattgccgatacctggtggcag
accgagaccggggcgcatatgattgcgccgctgcctggcgccatcgacctcaagccagga
tcctgcacccgccccctgcccggcatcatcatggatattgtcgaagaggacggcacccat
atcgaaggcaccggcggcggcctgttggtggtgaagaagccgtggccctcgatgatacgc
aacatctggggcaatcctgaacgattcaggaaagcctatttccccgaagagctcaacggg
ctgtacctggcaggcgattcggcgcaccgtgatgaagacggttatttctggatcatgggc
cgcatcgatgatgtactcaacgtttccggccaccgcttgggcaccatggagatcgaatct
gccctggttgccaaccccttggtggctgaagcagccattgtcggtaaaccgcacgatatc
aagggcgaatccattgtggcctatgtagtgctcaagggtgagcggcctgagggcgaagcc
gccaaaaccattgccggtcagttgcgcgagtgggtaggcaaggaaataggcccgatcgcc
aagccagacgaaatccgcttcggcgagaacctgcccaagacgcgctccggcaagatcatg
cgccgcctgctgcgctcgctcgccaagggagaggaaatcacatcggacatttcgacgctg
gacaatcccgccattctcgatcagctcagacagtcagcgggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system