KEGG   Methylobacillus flagellatus: Mfla_1921Help
Entry
Mfla_1921         CDS       T00342                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_1921
   00030 Pentose phosphate pathway
    Mfla_1921
   00051 Fructose and mannose metabolism
    Mfla_1921
   00052 Galactose metabolism
    Mfla_1921
   00500 Starch and sucrose metabolism
    Mfla_1921
   00520 Amino sugar and nucleotide sugar metabolism
    Mfla_1921
  Nucleotide metabolism
   00230 Purine metabolism
    Mfla_1921
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mfla_1921
Enzymes [BR:mfa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mfla_1921
    5.4.2.8  phosphomannomutase
     Mfla_1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2060239..2061612
Genome map
AA seq 457 aa AA seqDB search
MTAPKEIFKAYDIRGIVGKTLTPEIVESIGHAIGSEAALRDQKTICIGYDGRLSGPELAA
ALSRGIRKSGLDVINLGLVATPMVYFAAYHLQTGSGVMVTGSHNPPEYNGLKMVLAGETL
SGDTIQRLRARIDNNDFVHGNGTESSHDIAPAYIERIASDIKLKRPIKLTVDCGNGVPGA
FAGKLYRALGCEVEELFCEVDGHFPNHHPDPSVPENLKDLIENLLAGQSEIGFAFDGDGD
RLGVVTKDGSIIYPDRQLLLFAEDVLKRSPKATIIYDVKSTRNLSPWIKQRGGEPLMWKT
GHSLVKAKMKETGAALAGEMSGHIFFKERWYGFDDGLYSGARLLEILSQFDDPSAVLNAL
PDSVSTPEQHIHMREGEPHRLISELQASAKFEGANEVITIDGLRVEYSDGFGLMRPSNTT
PVIVLRFEADNAEALKRIQEQFRSVILAAAPNAKLPF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaccaaaagaaatcttcaaagcttacgatatccgcggcatcgtcggtaaaacc
ctgaccccggaaatcgtggagtccatcggccatgcgatcggcagcgaagctgcgctgcgt
gaccagaaaactatctgtatcggctatgacggccgcctatccggccccgagcttgccgca
gcgctttcgcgcggtatccgcaagagcggcctggatgtgatcaatctcgggctagtagcg
actcctatggtatatttcgccgcctaccatcttcagaccggttccggcgtcatggtgacc
ggcagccataacccgcccgaatacaacggcttgaaaatggtcttggcaggcgaaaccttg
tccggcgacaccatacaacggctgcgcgcgcgtatcgacaacaacgacttcgttcatggc
aacggcacggaaagcagccacgacattgcccctgcctatattgaacgcatagcctccgac
atcaagctcaagcgtcccatcaagctgacagtggattgcggcaacggcgtccccggcgct
tttgcaggcaagctttaccgcgcgctcggctgcgaggtggaggaattgttctgcgaagtg
gatgggcatttccccaaccatcaccctgatccttcagtcccggaaaatctcaaggacctg
atcgaaaacctgctggcaggtcaatccgaaatcgggttcgctttcgatggcgacggcgac
cgtctcggcgtggtcaccaaggatggcagcatcatctacccggatcgacaactactgctg
ttcgccgaggatgtgctcaagcgcagccccaaggctaccatcatttacgacgtcaaatcc
acgcgcaacctttccccctggatcaagcagcgcggcggcgagccattgatgtggaaaacc
ggacactccctggtcaaggccaagatgaaggaaaccggcgctgcgttggctggtgagatg
agcgggcatatatttttcaaggaacgctggtacggcttcgacgacggcttgtattccggc
gcgcgcctgctggaaatcctcagccagttcgacgatccttccgccgtgctcaatgcgttg
cccgacagcgtcagcacccctgagcagcatatccacatgcgggaaggagagccgcaccgc
ttaatcagcgagctgcaggccagcgccaagttcgaaggggcaaacgaagtcatcactatc
gacggcttgcgtgtcgaatacagtgatggtttcggcctgatgcgcccttccaacactacg
cccgtgatcgtcttgcgcttcgaagcggacaatgccgaggcgctcaagcgtattcaggaa
caattccgcagcgtcatcctggctgccgcgcctaacgccaagctacctttctga

DBGET integrated database retrieval system