KEGG   Methylobacillus flagellatus: Mfla_2010Help
Entry
Mfla_2010         CDS       T00342                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00521  Streptomycin biosynthesis
mfa00523  Polyketide sugar unit biosynthesis
mfa01130  Biosynthesis of antibiotics
Module
mfa_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Mfla_2010
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mfla_2010
Enzymes [BR:mfa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Mfla_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ABE50277
JGI: Mfla2010
UniProt: Q1GZR0
Position
2148222..2148770
Genome map
AA seq 182 aa AA seqDB search
MNVTPTHIPDVIVFEPKIFGDARGFFFESFNQKAFEEAVGRKYDFVQDNHSKSSKGVLRG
LHYQIQQAQGKLVRVVAGEVFDVAVDIRKSSPTFGQWVGQHLSAENKKQMWVPPGFAHGF
LVLSETAEFLYKTTDFYAPAHERCLSWNDPVVGIEWPDIGTPPLLSSKDQQGLGLHQTEL
FA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtcacgcccacccatattcctgatgtgatcgtattcgaacccaagatattcggt
gatgcccggggattcttttttgaaagcttcaatcagaaagcctttgaggaagccgtcggc
aggaaatatgattttgtacaagacaaccactcaaaatcctcaaaaggagtattgagaggg
ctacattatcagatccagcaagcccaaggaaaattggttagagtagtagcaggtgaagtt
tttgacgttgccgtggatatccgcaaatcttctccaacctttggtcaatgggtagggcaa
catctgtcagcagaaaacaagaaacaaatgtgggtaccaccaggttttgcccacggcttc
ctcgtgctgtccgaaactgcagagtttctctataagaccacagacttctacgcgcctgcg
catgaacgttgcctaagctggaacgatcccgttgttggtattgaatggccagatattggc
acgcccccgctcctctcaagtaaagatcaacaaggcttaggcctccaccagacagagtta
ttcgcataa

DBGET integrated database retrieval system