KEGG   Methylobacillus flagellatus: Mfla_2064Help
Entry
Mfla_2064         CDS       T00342                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfla_2064
   01230 Biosynthesis of amino acids
    Mfla_2064
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_2064
   00051 Fructose and mannose metabolism
    Mfla_2064
   00562 Inositol phosphate metabolism
    Mfla_2064
Enzymes [BR:mfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mfla_2064
Exosome [BR:mfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mfla_2064
  Exosomal proteins of bladder cancer cells
   Mfla_2064
  Exosomal proteins of melanoma cells
   Mfla_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2204436..2205188)
Genome map
AA seq 250 aa AA seqDB search
MRRKLVVGNWKMNGNLAQNKRLLEALVRGLQDVEHVDIAVCVPYPYLFQAQKILSGTNIA
WGAQNVAKHENGAYTGEVSAAMLKEFGASYVIVGHSERSDAYCESNANIAEKFAIAKHYG
ITPIFCVGETLQERESGVMEYAIANQLDAVLSVSGGALLDQAVIAYEPVWAIGTNRTATP
EQARAAHSFIRERIAAMHPGAAESVRIIYGGSVNPRNAAQLLSMPDIDGGLIGRCSLDAD
DFERICRAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaagctggttgtcggcaactggaaaatgaatggcaaccttgctcagaacaag
cggttgctggaagcgcttgtgcgtggcttgcaggatgttgagcatgtggatatcgctgta
tgcgtcccttatccctacctgttccaggcccagaaaatactcagcggtaccaatatcgcc
tggggcgcgcagaatgtggccaagcatgaaaatggcgcttataccggcgaagtcagcgcc
gccatgctcaaggagttcggtgccagctatgtcattgttgggcactcggaacgcagcgat
gcctattgtgaaagcaatgccaatattgccgagaagttcgcgatcgccaagcattacggc
atcacacccatcttctgcgtcggggaaaccctgcaggagcgcgagtcaggggtgatggag
tacgcaattgccaatcagctggatgcggtactttctgtctcggggggcgctttactcgac
caggcagtcattgcctatgagcctgtatgggcgatcggcaccaacaggacagccacgccg
gaacaggcacgtgctgcgcattctttcatacgcgagcgtatcgccgccatgcatccgggg
gcggccgaaagcgtaagaatcatctacgggggtagcgtaaacccgagaaatgcggcacaa
ttgctgtctatgccggatatagacggcggattgatcggcaggtgttccttggatgctgat
gattttgaaagaatttgccgcgctgcttgctga

DBGET integrated database retrieval system