KEGG   Methylobacillus flagellatus: Mfla_2064Help
Entry
Mfla_2064         CDS       T00342                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00010  Glycolysis / Gluconeogenesis
mfa00051  Fructose and mannose metabolism
mfa00562  Inositol phosphate metabolism
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01120  Microbial metabolism in diverse environments
mfa01130  Biosynthesis of antibiotics
mfa01200  Carbon metabolism
mfa01230  Biosynthesis of amino acids
Module
mfa_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_2064
   00051 Fructose and mannose metabolism
    Mfla_2064
   00562 Inositol phosphate metabolism
    Mfla_2064
Enzymes [BR:mfa01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Mfla_2064
Exosome [BR:mfa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Mfla_2064
  Exosomal proteins of bladder cancer cells
   Mfla_2064
  Exosomal proteins of melanoma cells
   Mfla_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABE50331
JGI: Mfla2064
UniProt: Q1GZK6
Position
complement(2204436..2205188)
Genome map
AA seq 250 aa AA seqDB search
MRRKLVVGNWKMNGNLAQNKRLLEALVRGLQDVEHVDIAVCVPYPYLFQAQKILSGTNIA
WGAQNVAKHENGAYTGEVSAAMLKEFGASYVIVGHSERSDAYCESNANIAEKFAIAKHYG
ITPIFCVGETLQERESGVMEYAIANQLDAVLSVSGGALLDQAVIAYEPVWAIGTNRTATP
EQARAAHSFIRERIAAMHPGAAESVRIIYGGSVNPRNAAQLLSMPDIDGGLIGRCSLDAD
DFERICRAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgcaagctggttgtcggcaactggaaaatgaatggcaaccttgctcagaacaag
cggttgctggaagcgcttgtgcgtggcttgcaggatgttgagcatgtggatatcgctgta
tgcgtcccttatccctacctgttccaggcccagaaaatactcagcggtaccaatatcgcc
tggggcgcgcagaatgtggccaagcatgaaaatggcgcttataccggcgaagtcagcgcc
gccatgctcaaggagttcggtgccagctatgtcattgttgggcactcggaacgcagcgat
gcctattgtgaaagcaatgccaatattgccgagaagttcgcgatcgccaagcattacggc
atcacacccatcttctgcgtcggggaaaccctgcaggagcgcgagtcaggggtgatggag
tacgcaattgccaatcagctggatgcggtactttctgtctcggggggcgctttactcgac
caggcagtcattgcctatgagcctgtatgggcgatcggcaccaacaggacagccacgccg
gaacaggcacgtgctgcgcattctttcatacgcgagcgtatcgccgccatgcatccgggg
gcggccgaaagcgtaagaatcatctacgggggtagcgtaaacccgagaaatgcggcacaa
ttgctgtctatgccggatatagacggcggattgatcggcaggtgttccttggatgctgat
gattttgaaagaatttgccgcgctgcttgctga

DBGET integrated database retrieval system