KEGG   Methylobacillus flagellatus: Mfla_2075Help
Entry
Mfla_2075         CDS       T00342                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mfa  Methylobacillus flagellatus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mfla_2075
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_2075
   00020 Citrate cycle (TCA cycle)
    Mfla_2075
   00620 Pyruvate metabolism
    Mfla_2075
Enzymes [BR:mfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mfla_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2217738..2219066
Genome map
AA seq 442 aa AA seqDB search
MAIKDVLVPDIGNFDSVDVIEVLVSAGDTIAKDDSLITLESDKASMDIPAPFSGTVKEVK
VKVGDKVAQGTLILTMDALEEGASAAPAPKEDAPPVQVAVPAPVPEATRPAPEPPPTIQP
QATPNPIGASVATASGKLAHASPSVRKFARELGVNLALVTATGPKNRITQSDVQAYVKNE
LSKPRGGGIATGAGGLAVIPAPVIDFSQYGDTETKPLSRIKKLSGANLHRNWVTAPHVTQ
FDEADITDLEDFRKSMQSEAEKRGVKLTMLAFLIKASVNALRAYPNFNASLSADGESLIL
KQYYNVGFACDTPDGLVVPVIRDVNRKDVLEIAAELGELSAKARERKLKVEEMQGGCFTI
SSLGGIGGTAFTPIINCPEVAILGVSRSSIRPVYNSKTKEFEPRLVLPLSLSYDHRVIDG
ADGARFTSHLRMVLSDVRRLLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagacgtactcgttcccgacatcggcaactttgacagcgtggatgtcatc
gaagtcttggtcagcgccggtgacaccattgccaaggacgattcactgatcaccctggag
tccgacaaggcctcgatggatattccggcgccattttcaggtaccgtcaaggaagtgaag
gtcaaggtaggtgacaaggttgcccaaggcaccctcatcctgaccatggacgccctagag
gaaggcgccagcgcagcccctgccccgaaagaggacgccccgccagtccaggttgcggtg
ccagcccctgtgcccgaagccacccgcccggcaccagaacctccaccgaccatccaacca
caagccacccccaaccccataggcgccagtgttgcaaccgcatcaggtaaactcgcacac
gccagcccgtcggtgcgtaagttcgcgcgcgagctgggagttaacctggcgctggtcacc
gccaccggtcccaagaaccgcattacgcaaagtgacgtccaggcctatgtcaaaaacgaa
ctaagcaagccgcgcggcggtggtatcgccactggcgcgggcggacttgccgtcatccca
gcacccgtcatcgatttttcacaatatggcgacaccgagaccaaaccgctctcccgcatc
aagaaactttccggcgccaaccttcatcgcaactgggtgaccgcgccgcacgtcacgcag
ttcgatgaagccgatattaccgaccttgaagacttccgcaaatccatgcagtccgaagct
gagaagcgcggcgtcaagctcaccatgctcgctttcctcatcaaggcctcggtcaatgca
ttgcgcgcctaccctaacttcaatgcttcactgtctgccgatggcgaaagcctgatcctc
aagcagtattacaatgtcggcttcgcctgcgataccccggacggtctggtagtgcccgtg
atccgcgatgtcaaccgcaaggacgtgcttgaaatcgctgccgagctgggcgagctttct
gccaaggcacgtgaacgcaaactcaaggtcgaggaaatgcagggcggctgttttaccatc
tccagcctggggggcattggcggtacggctttcacccccatcatcaattgcccagaagtg
gcaattctgggcgtctcgcgctccagcatccggccggtatacaacagtaagaccaaggag
ttcgagccgcgcctggtcctgcctttgtccctatcttatgaccaccgcgtgatcgacggt
gccgatggtgcacgcttcaccagtcacctgcgcatggtactgtccgacgtgcgtcgtttg
ttgctgtaa

DBGET integrated database retrieval system