KEGG   Methylobacillus flagellatus: Mfla_2075Help
Entry
Mfla_2075         CDS       T00342                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00010  Glycolysis / Gluconeogenesis
mfa00020  Citrate cycle (TCA cycle)
mfa00620  Pyruvate metabolism
mfa01100  Metabolic pathways
mfa01110  Biosynthesis of secondary metabolites
mfa01120  Microbial metabolism in diverse environments
mfa01130  Biosynthesis of antibiotics
mfa01200  Carbon metabolism
Module
mfa_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mfla_2075
   00020 Citrate cycle (TCA cycle)
    Mfla_2075
   00620 Pyruvate metabolism
    Mfla_2075
Enzymes [BR:mfa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mfla_2075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H RnfC_N HlyD_3 HlyD_D23 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABE50342
JGI: Mfla2075
UniProt: Q1GZJ5
Position
2217738..2219066
Genome map
AA seq 442 aa AA seqDB search
MAIKDVLVPDIGNFDSVDVIEVLVSAGDTIAKDDSLITLESDKASMDIPAPFSGTVKEVK
VKVGDKVAQGTLILTMDALEEGASAAPAPKEDAPPVQVAVPAPVPEATRPAPEPPPTIQP
QATPNPIGASVATASGKLAHASPSVRKFARELGVNLALVTATGPKNRITQSDVQAYVKNE
LSKPRGGGIATGAGGLAVIPAPVIDFSQYGDTETKPLSRIKKLSGANLHRNWVTAPHVTQ
FDEADITDLEDFRKSMQSEAEKRGVKLTMLAFLIKASVNALRAYPNFNASLSADGESLIL
KQYYNVGFACDTPDGLVVPVIRDVNRKDVLEIAAELGELSAKARERKLKVEEMQGGCFTI
SSLGGIGGTAFTPIINCPEVAILGVSRSSIRPVYNSKTKEFEPRLVLPLSLSYDHRVIDG
ADGARFTSHLRMVLSDVRRLLL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggcaattaaagacgtactcgttcccgacatcggcaactttgacagcgtggatgtcatc
gaagtcttggtcagcgccggtgacaccattgccaaggacgattcactgatcaccctggag
tccgacaaggcctcgatggatattccggcgccattttcaggtaccgtcaaggaagtgaag
gtcaaggtaggtgacaaggttgcccaaggcaccctcatcctgaccatggacgccctagag
gaaggcgccagcgcagcccctgccccgaaagaggacgccccgccagtccaggttgcggtg
ccagcccctgtgcccgaagccacccgcccggcaccagaacctccaccgaccatccaacca
caagccacccccaaccccataggcgccagtgttgcaaccgcatcaggtaaactcgcacac
gccagcccgtcggtgcgtaagttcgcgcgcgagctgggagttaacctggcgctggtcacc
gccaccggtcccaagaaccgcattacgcaaagtgacgtccaggcctatgtcaaaaacgaa
ctaagcaagccgcgcggcggtggtatcgccactggcgcgggcggacttgccgtcatccca
gcacccgtcatcgatttttcacaatatggcgacaccgagaccaaaccgctctcccgcatc
aagaaactttccggcgccaaccttcatcgcaactgggtgaccgcgccgcacgtcacgcag
ttcgatgaagccgatattaccgaccttgaagacttccgcaaatccatgcagtccgaagct
gagaagcgcggcgtcaagctcaccatgctcgctttcctcatcaaggcctcggtcaatgca
ttgcgcgcctaccctaacttcaatgcttcactgtctgccgatggcgaaagcctgatcctc
aagcagtattacaatgtcggcttcgcctgcgataccccggacggtctggtagtgcccgtg
atccgcgatgtcaaccgcaaggacgtgcttgaaatcgctgccgagctgggcgagctttct
gccaaggcacgtgaacgcaaactcaaggtcgaggaaatgcagggcggctgttttaccatc
tccagcctggggggcattggcggtacggctttcacccccatcatcaattgcccagaagtg
gcaattctgggcgtctcgcgctccagcatccggccggtatacaacagtaagaccaaggag
ttcgagccgcgcctggtcctgcctttgtccctatcttatgaccaccgcgtgatcgacggt
gccgatggtgcacgcttcaccagtcacctgcgcatggtactgtccgacgtgcgtcgtttg
ttgctgtaa

DBGET integrated database retrieval system