KEGG   Methylobacillus flagellatus: Mfla_2102Help
Entry
Mfla_2102         CDS       T00342                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mfa  Methylobacillus flagellatus
Pathway
mfa00240  Pyrimidine metabolism
mfa00250  Alanine, aspartate and glutamate metabolism
mfa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Mfla_2102
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mfla_2102
Enzymes [BR:mfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Mfla_2102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ABE50369
JGI: Mfla2102
UniProt: Q1GZG8
Position
2249190..2250143
Genome map
AA seq 317 aa AA seqDB search
MHNPQLTKDGKLKHLLTTEGLPRAILNQILDTAESFVGVAEREVKKVPLLRGKTVCNIFF
ENSTRTRTTFEIAAKRLSADVITLNVSTSSQSKGETILDTIDNLTAMHADMFVVRHAESG
AAHFIARHVAPHIHVINAGDGRHAHPTQGLLDVFTIRRYKPDMHNLRVAVVGDVLHSRVA
RSEIHALTTLGVPEVRVIAPKTLLPQHVEKLGVHVYHDMREGLKDIDVVMMLRLQNERMN
GSLLPSAQEYFKCYGLTPEKLAFAKPDAIVMHPGPMNRGVEIDSAVADGKQSVILPQVTY
GIAVRMAVMSILAGNSE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcataaccctcaattgaccaaggatggaaaactcaagcatctgcttacgactgaaggc
ctgccccgcgccatcctcaaccagatactggatactgccgagtccttcgtcggcgtggcc
gagcgtgaggttaaaaaagtaccattgctgcgtggcaagaccgtctgcaatattttcttc
gagaacagcacacgcacccggacgacattcgaaattgcagccaaacgcctctccgcagat
gtcatcaccctcaatgtgagcacttcctcgcaatccaagggtgagaccattctcgacacc
attgacaacctgaccgccatgcatgccgacatgttcgtggtacgccatgccgaatcaggc
gccgctcatttcattgcccgccatgtggctccgcatatccatgtcatcaatgcgggagat
ggccgccacgcccaccctacccagggtttactcgacgtattcaccatccgccgttataag
ccggacatgcataacctgcgcgtggccgtggtcggcgatgtgctgcactcccgtgtcgcg
cgttcggaaattcatgcgctcactaccctaggcgtgcccgaggttcgcgtcatcgcgccc
aagaccttgttaccgcagcacgtggaaaaactgggcgtgcacgtctaccacgatatgcgt
gaagggttaaaggatattgatgtcgtcatgatgctgcgcttgcagaacgaacgcatgaat
ggctccctgctgcccagtgcccaggaatatttcaagtgctacgggctcacgccggagaaa
cttgcctttgcgaagccggatgccatcgtcatgcatccaggccccatgaaccgcggcgta
gagattgactccgccgtggctgatggcaaacaatccgtgattcttccccaggttacctat
ggcattgcagttcgcatggccgtcatgagcatcctcgcaggaaactccgaatga

DBGET integrated database retrieval system