KEGG   Methylobacillus flagellatus: Mfla_2531Help
Entry
Mfla_2531         CDS       T00342                                 

Definition
(GenBank) protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mfa  Methylobacillus flagellatus
Brite
Enzymes [BR:mfa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mfla_2531
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 MTS Methyltransf_23 Methyltransf_12 Methyltransf_18 Methyltransf_11 Methyltransf_4 NodS Methyltransf_32 Methyltransf_24 CMAS GCD14 MetW DUF3419 DREV
Motif
Other DBs
NCBI-ProteinID: ABE50796
JGI: Mfla2531
UniProt: Q1GY91
Position
2714814..2715470
Genome map
AA seq 218 aa AA seqDB search
MHHDVEQARFNMIEQQIRPWEVLDGTVLDLLGRVPREAFVPEQYRGLAFADIEIPIGFGQ
TMLSPKMEGRILQSLEIKPTDKVLEIGTGSGYFTALLASLAQEVHSVEINAELSNQAHLK
LLQQQIHNVTLHIGDGARGWPGNAPYDVIVFTGSLALPPLINDQLRVGGRLFAVIGEPPV
MEATIMRRISEDAVRQDVIFETTLPQLENAPQPEKFDF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcaccatgatgtagaacaagcccgcttcaacatgatagagcagcagatccgcccctgg
gaggtgcttgacggcaccgtgctcgaccttttgggccgcgtgccgcgcgaagcgtttgtc
cccgagcaatatcgcggcctggcgtttgccgatatcgaaatccccatcggcttcggccag
accatgctttcccccaagatggaaggccgcatcctgcaatcgctggaaatcaagccaacc
gataaagtcctggaaatcggcaccggcagcggctacttcaccgccctgcttgcctcactt
gcgcaagaggtgcacagcgtcgagatcaatgccgaactcagcaatcaagcgcatctcaag
ctgcttcagcagcaaatccacaatgtgacgctgcatataggagacggcgcacgtgggtgg
ccgggcaatgccccctatgacgtgatcgtcttcaccggttcactggccctgccgccgctg
ataaacgatcagttgcgcgtcggcggcaggttgttcgccgtcattggcgagccccccgtg
atggaggccaccatcatgcgccgcatcagcgaagatgcggtacgccaggacgtgattttc
gaaaccacgcttcctcagctcgagaacgccccccagccggaaaaattcgatttctag

DBGET integrated database retrieval system