KEGG   Methanocaldococcus fervens: Mefer_0115Help
Entry
Mefer_0115        CDS       T00976                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00051  Fructose and mannose metabolism
mfe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mefer_0115
Enzymes [BR:mfe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mefer_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: ACV23957
JGI: Mefer_0115
UniProt: C7P5X5
Position
complement(108914..109459)
Genome map
AA seq 181 aa AA seqDB search
MDKRQFIEICKKLYERKYVVGSGGNVSVREGNRVYLTPTGSILGFLKEDDIAEMDLDGNI
IKGKPTSEKNLHLMIYRKRDDVNAIIHTHSLVSTFLSTINKEIDLLTPEGKIFLKRIGYV
DYFEAGSLKLAEETAKRDEDVIILKNHGVVCLGKDLIDAYVKVEVLEEQAKLTLLKLLVK
E
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaggcagtttattgagatatgtaaaaagctttatgaaagaaagtacgttgtt
ggtagtgggggaaacgtatcagttagagaaggcaatagagtctatttaacgccaaccgga
tctatcttaggatttttaaaggaggatgatattgctgagatggatttagacggcaacatt
ataaaaggaaagccaacttcagaaaaaaacttacacttaatgatttatagaaagagagat
gatgtaaatgcaataattcatactcattcacttgtttcaacctttttatcaacaataaat
aaggagattgatcttttaacaccagagggtaaaatatttttaaagagaattggatatgtc
gattattttgaagctggaagcttaaaattggctgaagaaactgcaaaaagagatgaagat
gtaattatattaaaaaatcatggagtagtttgcttaggaaaagatttaatagatgcctat
gtaaaggtggaagttttagaagagcaggcaaaactcacacttttaaaacttcttgtaaag
gaataa

DBGET integrated database retrieval system