KEGG   Methanocaldococcus fervens: Mefer_0143Help
Entry
Mefer_0143        CDS       T00976                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mfe  Methanocaldococcus fervens
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mfe00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
137812..138666
Genome map
AA seq 284 aa AA seqDB search
MKEHFIDLSKFIMANASYEDADGVIYSIPYDETTSFKPGTREGGNAIRTASWGLETYSPI
LDRDLSELKYCDLKDLDLYGNQVEIFNTIQSVSKEILKDGKKIIVFGGEHSITYPIVKAV
KDVYNDFIVIQFDAHCDLRDEYLGNKLSHACVMRRVYELTKDIFQFGIRSGDKEEWDFAK
ENNIYLKMDLMNEEDLEFIKSLDKPIYLTVDIDVLDPAYAPGTGTPEPCGFSTKELFNSL
YLLKEVKDRIIGFDIVEVSPIYDIANITAIAAAKIARELMLMIL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagcattttattgacctgtctaaatttataatggctaatgcatcttatgaggat
gccgatggagttatatactcaataccttacgatgaaacaacttcttttaaaccagggaca
agagaaggaggaaatgccataagaaccgcatcctggggattagagacctatagcccaata
ttggatagggatttatcagaattgaaatactgcgatttaaaggatttggatttgtatggg
aaccaagtagagatattcaatacaatccaatcagtttcaaaagaaatattaaaagatgga
aaaaaaatcattgtctttggtggagagcattctataacttatccaatagttaaggctgtg
aaagatgtttacaatgattttattgttattcaatttgacgcccattgtgatttaagggat
gagtatttagggaataagctgtctcatgcatgcgttatgaggagagtttatgagttaacc
aaagatatatttcaatttggtattagaagtggagataaagaggaatgggattttgcaaaa
gaaaataatatctacctaaaaatggatttaatgaatgaagaggatttagagtttataaaa
agtttggataaaccaatatatctaactgtggatattgacgtgttagaccctgcctatgcc
ccaggaactgggacgccagagccatgtggtttttcaacaaaagagttgtttaactcgtta
tatttattgaaagaggttaaagatagaattataggatttgatattgttgaagtttcccca
atttatgatattgcaaacattacagcaatagcagcggcaaaaattgcaagagaacttatg
ttgatgattctttaa

DBGET integrated database retrieval system