KEGG   Methanocaldococcus fervens: Mefer_0159Help
Entry
Mefer_0159        CDS       T00976                                 

Definition
4Fe-4S ferredoxin
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mfe  Methanocaldococcus fervens
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mfe01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mfe00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(155293..155739)
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAIVAMKLRRKGLLQKEIAEIIKSDRSIVSHYLSGRYPKEKILKVAEIFEE
LPPKYGAKLIHSLTDDKELAKNLIEELYNIKFLWDEKSCIACGSCLGCVALTLDNFTVNI
DYDACFLCASCIFRCPTNSLNFVRENYD
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatattctttcaggaataaaggcaatagtagcaatgaaattaagaagaaaa
ggactccttcaaaaagaaatagcagaaattattaaaagtgacaggtcaatagtttctcat
tatctttctggaaggtatccaaaggaaaaaatcttaaaagttgcggaaatttttgaagaa
cttccaccaaaatatggagctaagctcatccattctttaactgacgataaggagcttgca
aagaacttgatagaggaattatacaacataaaatttttgtgggatgaaaaatcctgcata
gcttgcggatcctgtttggggtgtgtagcactcacactcgacaacttcactgtcaatata
gattacgatgcctgctttttatgtgcatcttgtatattcagatgtcctacaaattcatta
aactttgtgagggagaattatgattga

DBGET integrated database retrieval system