KEGG   Methanocaldococcus fervens: Mefer_0159Help
Entry
Mefer_0159        CDS       T00976                                 

Definition
(GenBank) 4Fe-4S ferredoxin iron-sulfur binding domain protein
  KO
K00204  4Fe-4S ferredoxin
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00680  Methane metabolism
mfe01100  Metabolic pathways
mfe01120  Microbial metabolism in diverse environments
mfe01200  Carbon metabolism
Module
mfe_M00567  Methanogenesis, CO2 => methane
mfe_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Mefer_0159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_10 HTH_19 Fer4_21 HTH_3 Fer4_2 MgtE_N Fer4_9 Fer4_6 Fer4_16
Motif
Other DBs
NCBI-ProteinID: ACV24001
JGI: Mefer_0159
UniProt: C7P619
Position
complement(155293..155739)
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAIVAMKLRRKGLLQKEIAEIIKSDRSIVSHYLSGRYPKEKILKVAEIFEE
LPPKYGAKLIHSLTDDKELAKNLIEELYNIKFLWDEKSCIACGSCLGCVALTLDNFTVNI
DYDACFLCASCIFRCPTNSLNFVRENYD
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagagcatattctttcaggaataaaggcaatagtagcaatgaaattaagaagaaaa
ggactccttcaaaaagaaatagcagaaattattaaaagtgacaggtcaatagtttctcat
tatctttctggaaggtatccaaaggaaaaaatcttaaaagttgcggaaatttttgaagaa
cttccaccaaaatatggagctaagctcatccattctttaactgacgataaggagcttgca
aagaacttgatagaggaattatacaacataaaatttttgtgggatgaaaaatcctgcata
gcttgcggatcctgtttggggtgtgtagcactcacactcgacaacttcactgtcaatata
gattacgatgcctgctttttatgtgcatcttgtatattcagatgtcctacaaattcatta
aactttgtgagggagaattatgattga

DBGET integrated database retrieval system