KEGG   Methanocaldococcus fervens: Mefer_0208Help
Entry
Mefer_0208        CDS       T00976                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mfe  Methanocaldococcus fervens
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mefer_0208
Enzymes [BR:mfe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Mefer_0208
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(204352..205227)
Genome map
AA seq 291 aa AA seqDB search
MKLGIVTIDRDRVVDELIKSCERFNVDHKIINPMNILAGFNLNFKLKYYKSFLDELDCCF
VRNLGWDSFFRFDVLKYLNQYVPVINPPEGIDRASNKFLTSVFLELNNIPQPKTVVTESI
NEAIVWIDAFEEAVLKPIFGCEGEGIVKVKKDSPISVKLNILDEFRKKYKTFYIQEFIKP
LRNEYRDIRAFVIDDEVVAAMYRVGGDNWKNNVSQGGRVERCEITDEIEELSLKAKNALG
LFYAGVDLIESEEGLKVLEVNSTPSWIGLSKVSKVNIADKLLEKIIQHVKQ
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcttggcatagttacaatagatagggatagggttgtcgatgaattgataaaatct
tgtgagaggtttaatgttgatcacaaaattataaaccccatgaacattttagcaggattt
aatttaaattttaaactaaaatattacaaatcatttttagatgagttggattgctgtttt
gtgaggaatcttggctgggatagtttttttagatttgatgttttaaaatatttaaatcaa
tatgttccagttataaatcctcctgaagggatagatagggcttcaaacaaatttttaacc
tctgtttttcttgaattaaacaatatcccacaaccaaaaactgttgttacagaaagtata
aacgaggctatagtttggatagatgcatttgaagaagccgttttaaaaccgatatttgga
tgtgagggggagggaattgtaaaagttaaaaaagattctccaatttcagtaaaattaaat
atcttagatgaatttaggaagaaatataaaacattctatattcaggagtttataaaacct
ttaagaaatgagtatagggatataagggcttttgttattgatgatgaggttgttgcagca
atgtatagggttggaggggacaattggaaaaataatgtttctcaagggggaagggtggag
aggtgtgagataactgacgaaatagaggaattatctttaaaagcaaaaaatgctcttggt
ttattttatgctggagtcgatttaatcgaatcagaagaggggttaaaagttttggaggtt
aactcaacaccttcttggattggattatctaaggtttctaaagttaatatagctgacaaa
cttttagaaaaaataattcagcatgttaaacaataa

DBGET integrated database retrieval system