KEGG   Methanocaldococcus fervens: Mefer_0258Help
Entry
Mefer_0258        CDS       T00976                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00860  Porphyrin and chlorophyll metabolism
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mefer_0258
Enzymes [BR:mfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Mefer_0258
Exosome [BR:mfe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mefer_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACV24096
JGI: Mefer_0258
UniProt: C7P6B4
Position
254507..255478
Genome map
AA seq 323 aa AA seqDB search
MLIRPRRLRKNQKIRDLVRETTLTKNDLIMPIFVDENLKGNEKKEINSMPNQYRFSVEGA
IEEAKEIADLGIPAVILFGIPKHKDEMASSAYDKNGVVQRTLRGIKEELGDELLVIADCC
LCEYTSHGHCGIVKDGKILNDATLPILAKIALSYAEAGVDIVAPSDMMDGRVKAIREALE
ENGYDDVAIMSYSAKYASSFYGPFREAAESSPKFGDRKSYQMDIGNAREALKEIALDIEE
GADLILVKPALPYLDIIRMAKDTFNIPIGGYCVSGEYAMVEAAARNGWLDREKVIYEVLL
SIKRAGADFIITYWAKEVAKKLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgttaataagaccaagaaggttaagaaaaaatcaaaaaattagagatttagttagagaa
acaacattaacaaaaaatgacttaattatgccaatttttgtggatgaaaatctaaaagga
aatgaaaagaaggaaattaactcaatgccaaatcaatacaggtttagtgtagaaggggct
atagaagaggctaaagaaatagctgatttaggtattccagctgtgatattgtttggtatt
ccaaagcataaggatgagatggcaagctcagcatatgataaaaatggagtggttcaaaga
accctaagaggaattaaagaggagttaggggatgagcttttagttatagctgattgttgt
ttgtgtgaatacacaagccatggacattgtggaattgttaaggatgggaagattttaaat
gatgccactttaccaatattggcaaagatagccttatcttatgctgaggcaggggttgat
atcgtcgccccttcagatatgatggatggaagagttaaagctataagggaagctttagaa
gagaatggttatgatgatgttgctataatgagttattctgcaaaatatgcatcatcgttt
tatgggccgtttagagaagcggctgaaagctcgccaaagtttggagataggaagagttat
caaatggacattggaaatgcaagagaggctttaaaagagattgccttagatatagaggaa
ggggctgatttaattttggttaagccagctctaccatatttagatataataagaatggct
aaagatacttttaatatacctattggcggttactgcgttagtggagagtatgcgatggtt
gaagcagcggcaagaaatggatggctggatagggagaaagttatttatgaagtgttgtta
agtataaaaagggcgggagctgattttattataacatattgggctaaggaagttgctaag
aaactattataa

DBGET integrated database retrieval system