KEGG   Methanocaldococcus fervens: Mefer_0312Help
Entry
Mefer_0312        CDS       T00976                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe00620  Pyruvate metabolism
mfe00640  Propanoate metabolism
mfe00680  Methane metabolism
mfe00720  Carbon fixation pathways in prokaryotes
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01120  Microbial metabolism in diverse environments
mfe01130  Biosynthesis of antibiotics
mfe01200  Carbon metabolism
Module
mfe_M00357  Methanogenesis, acetate => methane
mfe_M00617  Methanogen
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0312
   00620 Pyruvate metabolism
    Mefer_0312
   00640 Propanoate metabolism
    Mefer_0312
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mefer_0312
   00680 Methane metabolism
    Mefer_0312
Enzymes [BR:mfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mefer_0312
Lipid biosynthesis proteins [BR:mfe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mefer_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ACV24148
JGI: Mefer_0312
UniProt: C7P6G6
Position
307954..309903
Genome map
AA seq 649 aa AA seqDB search
MINHDRLLTKFGVSMKFGDKYIPLEKFNKMREESLKNPEKFWGEQAKCLDWDKTWDKVLE
WNPPYARWFVNGKLNASYNCVDRHIKGSRRNKAAIIWENENGDCRTLTYYELYREVNKFA
NVLQNLGVDKGDRVAIYLPMIPEAVIAMLACARIGAIHTVVFSGFSSDALAERINDAGAE
VLITADILYRRGKKINLKNIVDKSLLDCPSINYVVYVHRDKDNDIKLKEGRDYLWDELMK
GAKKYVKPVSVESNHPLFILYTSGTTGKPKGVVHSTGGYLVYVTKTMEWTWGINDMDVFW
CTADIGWITGHSYVVYAPLSLGTTTVIYEGAIDYPNPGRIWEIIENHGVTILYTAPTAIR
MLMKYGEEWVKSHDLSTLRMLGSVGEPINPKAWEWYYEVVGQKRCPIADCYWQTETGGHI
IYPPLGIQNIPLKPGSATFPGIGIDADVVDENGNSLPPNKKGLLVIKNPWPGMLLGLWKN
DVRYRKAYWERIKNCYCPSDYAIKDEDGYFWILGRADEVLNVAGHRIGTAELEHVLVSHP
LVAEAAVIGKPDEIKGEVPVAFVIPRKEIDDKKEAKEQIIKYVRDTLGPVAAPTMIFFVN
KLPKTRSGKIMRRVLKKLILGEDLGDLSTIEDNTSIEEIKNELSDFVYE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcatgatagattattaacaaagtttggtgttagtatgaagtttggagataaa
tacatacctcttgaaaaattcaacaaaatgagagaagaatctttaaaaaatcctgagaaa
ttttggggtgagcaagcaaaatgcttagattgggataaaacttgggataaagttttagaa
tggaatcctccttatgccaggtggtttgtaaatggaaaattaaatgcaagttacaactgt
gtagataggcatataaaaggaagtaggaggaataaagctgcaataatatgggaaaacgaa
aatggagattgtaggacattaacttactatgaactttatagagaagtgaataagtttgca
aatgttttacagaatttgggagtagataaaggggacagggtagctatctacctcccaatg
attccagaggctgtaatagcgatgttggcatgtgcaagaattggggcaattcatacagta
gtattctctggtttttcatcagatgcacttgcagagagaataaacgatgctggagcagag
gttttaatcactgcagacatactttataggagaggaaagaagataaatctaaaaaatatc
gtagataaatccctcttagattgtccttcaataaactacgttgtttatgtccatagggat
aaagacaacgatataaaacttaaggaaggaagagattacctttgggatgaattaatgaaa
ggtgcaaagaagtatgtaaaaccagtatctgttgagtcaaatcatcccctattcatatta
tacacaagtggaactactggaaaaccaaaaggggttgtgcattctactggaggatatttg
gtttatgttacaaaaacgatggaatggacttggggaattaacgatatggatgtgttctgg
tgtactgcagatattggatggattaccgggcatagctacgttgtttatgcccctctaagc
ttaggaacaacaactgtaatatatgaaggggcgatagattatccaaatcctggaagaatc
tgggagattatagaaaatcatggagtaactatattatacactgctccaacagccataagg
atgctaatgaagtatggtgaagaatgggtgaagtctcacgacctatctactttgaggatg
ttaggaagtgttggagaaccaataaatccaaaagcttgggagtggtattatgaggttgta
ggacagaagagatgccctattgcagattgttattggcagacagaaactggaggacatata
atctatccaccattgggtattcaaaacatcccattaaagccgggttcagcaacatttcca
ggaattgggatagatgcagatgttgtagatgaaaatggaaacagcttacctccaaacaaa
aagggattgttagttattaaaaatccatggccagggatgctattgggattgtggaagaat
gatgtaaggtatagaaaggcatactgggagaggataaaaaattgttactgtccatcagat
tatgccattaaagatgaggatggctatttctggatacttggaagggctgatgaggtttta
aatgtagcagggcataggataggaacagcagagcttgagcacgtcctcgtttcacatcca
ttggttgctgaagctgcagttataggtaaacctgatgaaataaaaggagaggttcctgtt
gcgtttgtgattccaagaaaggaaatagatgataagaaagaggcgaaagaacaaattata
aaatatgttagagatactttaggacctgttgcagcccctactatgattttcttcgttaat
aagcttccaaaaacaagaagtggaaagattatgaggagagtgttaaaaaaactcatatta
ggagaggatttaggtgatttgtcaacaatagaggataacacaagtatagaagaaataaaa
aatgaattgtctgatttcgtttatgaataa

DBGET integrated database retrieval system