KEGG   Methanocaldococcus fervens: Mefer_0312Help
Entry
Mefer_0312        CDS       T00976                                 

Definition
(RefSeq) acetate/CoA ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_0312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0312
   00620 Pyruvate metabolism
    Mefer_0312
   00640 Propanoate metabolism
    Mefer_0312
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mefer_0312
   00680 Methane metabolism
    Mefer_0312
Enzymes [BR:mfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mefer_0312
Lipid biosynthesis proteins [BR:mfe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mefer_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
307954..309903
Genome map
AA seq 649 aa AA seqDB search
MINHDRLLTKFGVSMKFGDKYIPLEKFNKMREESLKNPEKFWGEQAKCLDWDKTWDKVLE
WNPPYARWFVNGKLNASYNCVDRHIKGSRRNKAAIIWENENGDCRTLTYYELYREVNKFA
NVLQNLGVDKGDRVAIYLPMIPEAVIAMLACARIGAIHTVVFSGFSSDALAERINDAGAE
VLITADILYRRGKKINLKNIVDKSLLDCPSINYVVYVHRDKDNDIKLKEGRDYLWDELMK
GAKKYVKPVSVESNHPLFILYTSGTTGKPKGVVHSTGGYLVYVTKTMEWTWGINDMDVFW
CTADIGWITGHSYVVYAPLSLGTTTVIYEGAIDYPNPGRIWEIIENHGVTILYTAPTAIR
MLMKYGEEWVKSHDLSTLRMLGSVGEPINPKAWEWYYEVVGQKRCPIADCYWQTETGGHI
IYPPLGIQNIPLKPGSATFPGIGIDADVVDENGNSLPPNKKGLLVIKNPWPGMLLGLWKN
DVRYRKAYWERIKNCYCPSDYAIKDEDGYFWILGRADEVLNVAGHRIGTAELEHVLVSHP
LVAEAAVIGKPDEIKGEVPVAFVIPRKEIDDKKEAKEQIIKYVRDTLGPVAAPTMIFFVN
KLPKTRSGKIMRRVLKKLILGEDLGDLSTIEDNTSIEEIKNELSDFVYE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcatgatagattattaacaaagtttggtgttagtatgaagtttggagataaa
tacatacctcttgaaaaattcaacaaaatgagagaagaatctttaaaaaatcctgagaaa
ttttggggtgagcaagcaaaatgcttagattgggataaaacttgggataaagttttagaa
tggaatcctccttatgccaggtggtttgtaaatggaaaattaaatgcaagttacaactgt
gtagataggcatataaaaggaagtaggaggaataaagctgcaataatatgggaaaacgaa
aatggagattgtaggacattaacttactatgaactttatagagaagtgaataagtttgca
aatgttttacagaatttgggagtagataaaggggacagggtagctatctacctcccaatg
attccagaggctgtaatagcgatgttggcatgtgcaagaattggggcaattcatacagta
gtattctctggtttttcatcagatgcacttgcagagagaataaacgatgctggagcagag
gttttaatcactgcagacatactttataggagaggaaagaagataaatctaaaaaatatc
gtagataaatccctcttagattgtccttcaataaactacgttgtttatgtccatagggat
aaagacaacgatataaaacttaaggaaggaagagattacctttgggatgaattaatgaaa
ggtgcaaagaagtatgtaaaaccagtatctgttgagtcaaatcatcccctattcatatta
tacacaagtggaactactggaaaaccaaaaggggttgtgcattctactggaggatatttg
gtttatgttacaaaaacgatggaatggacttggggaattaacgatatggatgtgttctgg
tgtactgcagatattggatggattaccgggcatagctacgttgtttatgcccctctaagc
ttaggaacaacaactgtaatatatgaaggggcgatagattatccaaatcctggaagaatc
tgggagattatagaaaatcatggagtaactatattatacactgctccaacagccataagg
atgctaatgaagtatggtgaagaatgggtgaagtctcacgacctatctactttgaggatg
ttaggaagtgttggagaaccaataaatccaaaagcttgggagtggtattatgaggttgta
ggacagaagagatgccctattgcagattgttattggcagacagaaactggaggacatata
atctatccaccattgggtattcaaaacatcccattaaagccgggttcagcaacatttcca
ggaattgggatagatgcagatgttgtagatgaaaatggaaacagcttacctccaaacaaa
aagggattgttagttattaaaaatccatggccagggatgctattgggattgtggaagaat
gatgtaaggtatagaaaggcatactgggagaggataaaaaattgttactgtccatcagat
tatgccattaaagatgaggatggctatttctggatacttggaagggctgatgaggtttta
aatgtagcagggcataggataggaacagcagagcttgagcacgtcctcgtttcacatcca
ttggttgctgaagctgcagttataggtaaacctgatgaaataaaaggagaggttcctgtt
gcgtttgtgattccaagaaaggaaatagatgataagaaagaggcgaaagaacaaattata
aaatatgttagagatactttaggacctgttgcagcccctactatgattttcttcgttaat
aagcttccaaaaacaagaagtggaaagattatgaggagagtgttaaaaaaactcatatta
ggagaggatttaggtgatttgtcaacaatagaggataacacaagtatagaagaaataaaa
aatgaattgtctgatttcgtttatgaataa

DBGET integrated database retrieval system