KEGG   Methanocaldococcus fervens: Mefer_0312Help
Entry
Mefer_0312        CDS       T00976                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_0312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0312
   00620 Pyruvate metabolism
    Mefer_0312
   00640 Propanoate metabolism
    Mefer_0312
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mefer_0312
   00680 Methane metabolism
    Mefer_0312
Enzymes [BR:mfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mefer_0312
Lipid biosynthesis proteins [BR:mfe01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mefer_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
307954..309903
Genome map
AA seq 649 aa AA seqDB search
MINHDRLLTKFGVSMKFGDKYIPLEKFNKMREESLKNPEKFWGEQAKCLDWDKTWDKVLE
WNPPYARWFVNGKLNASYNCVDRHIKGSRRNKAAIIWENENGDCRTLTYYELYREVNKFA
NVLQNLGVDKGDRVAIYLPMIPEAVIAMLACARIGAIHTVVFSGFSSDALAERINDAGAE
VLITADILYRRGKKINLKNIVDKSLLDCPSINYVVYVHRDKDNDIKLKEGRDYLWDELMK
GAKKYVKPVSVESNHPLFILYTSGTTGKPKGVVHSTGGYLVYVTKTMEWTWGINDMDVFW
CTADIGWITGHSYVVYAPLSLGTTTVIYEGAIDYPNPGRIWEIIENHGVTILYTAPTAIR
MLMKYGEEWVKSHDLSTLRMLGSVGEPINPKAWEWYYEVVGQKRCPIADCYWQTETGGHI
IYPPLGIQNIPLKPGSATFPGIGIDADVVDENGNSLPPNKKGLLVIKNPWPGMLLGLWKN
DVRYRKAYWERIKNCYCPSDYAIKDEDGYFWILGRADEVLNVAGHRIGTAELEHVLVSHP
LVAEAAVIGKPDEIKGEVPVAFVIPRKEIDDKKEAKEQIIKYVRDTLGPVAAPTMIFFVN
KLPKTRSGKIMRRVLKKLILGEDLGDLSTIEDNTSIEEIKNELSDFVYE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgatcaatcatgatagattattaacaaagtttggtgttagtatgaagtttggagataaa
tacatacctcttgaaaaattcaacaaaatgagagaagaatctttaaaaaatcctgagaaa
ttttggggtgagcaagcaaaatgcttagattgggataaaacttgggataaagttttagaa
tggaatcctccttatgccaggtggtttgtaaatggaaaattaaatgcaagttacaactgt
gtagataggcatataaaaggaagtaggaggaataaagctgcaataatatgggaaaacgaa
aatggagattgtaggacattaacttactatgaactttatagagaagtgaataagtttgca
aatgttttacagaatttgggagtagataaaggggacagggtagctatctacctcccaatg
attccagaggctgtaatagcgatgttggcatgtgcaagaattggggcaattcatacagta
gtattctctggtttttcatcagatgcacttgcagagagaataaacgatgctggagcagag
gttttaatcactgcagacatactttataggagaggaaagaagataaatctaaaaaatatc
gtagataaatccctcttagattgtccttcaataaactacgttgtttatgtccatagggat
aaagacaacgatataaaacttaaggaaggaagagattacctttgggatgaattaatgaaa
ggtgcaaagaagtatgtaaaaccagtatctgttgagtcaaatcatcccctattcatatta
tacacaagtggaactactggaaaaccaaaaggggttgtgcattctactggaggatatttg
gtttatgttacaaaaacgatggaatggacttggggaattaacgatatggatgtgttctgg
tgtactgcagatattggatggattaccgggcatagctacgttgtttatgcccctctaagc
ttaggaacaacaactgtaatatatgaaggggcgatagattatccaaatcctggaagaatc
tgggagattatagaaaatcatggagtaactatattatacactgctccaacagccataagg
atgctaatgaagtatggtgaagaatgggtgaagtctcacgacctatctactttgaggatg
ttaggaagtgttggagaaccaataaatccaaaagcttgggagtggtattatgaggttgta
ggacagaagagatgccctattgcagattgttattggcagacagaaactggaggacatata
atctatccaccattgggtattcaaaacatcccattaaagccgggttcagcaacatttcca
ggaattgggatagatgcagatgttgtagatgaaaatggaaacagcttacctccaaacaaa
aagggattgttagttattaaaaatccatggccagggatgctattgggattgtggaagaat
gatgtaaggtatagaaaggcatactgggagaggataaaaaattgttactgtccatcagat
tatgccattaaagatgaggatggctatttctggatacttggaagggctgatgaggtttta
aatgtagcagggcataggataggaacagcagagcttgagcacgtcctcgtttcacatcca
ttggttgctgaagctgcagttataggtaaacctgatgaaataaaaggagaggttcctgtt
gcgtttgtgattccaagaaaggaaatagatgataagaaagaggcgaaagaacaaattata
aaatatgttagagatactttaggacctgttgcagcccctactatgattttcttcgttaat
aagcttccaaaaacaagaagtggaaagattatgaggagagtgttaaaaaaactcatatta
ggagaggatttaggtgatttgtcaacaatagaggataacacaagtatagaagaaataaaa
aatgaattgtctgatttcgtttatgaataa

DBGET integrated database retrieval system