KEGG   Methanocaldococcus fervens: Mefer_0470Help
Entry
Mefer_0470        CDS       T00976                                 

Definition
succinyl-CoA synthetase, beta subunit
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfe  Methanocaldococcus fervens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mfe01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mfe00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mfe00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mfe00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(447657..448754)
Genome map
AA seq 365 aa AA seqDB search
MKLHEYEAKNIFKEYGIPVPESFLISKEDDLSNIDIDKEVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIVDRDAKKPLIIFSTKGG
VDIEEIAEKEPEKIVKYHVDVKKPFLPYVARWIVKEAKVPSEEIGKVADIIYKLYKIFKD
WDATMVEINPLVITKDKNVYAADAVIHLDDDAAFRHRYEEFEEFKNKEKLPFAYVELDGD
IAVIGNGAGLTLASMDVINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNIKFAVRMMGTNEDIGRKVLEEHGIPYETSMEEAGKKL
IELLS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacatgaatatgaagcaaaaaatatatttaaagagtatggtatcccagtaccc
gagagctttttaatatcaaaggaagatgacttaagcaacatagatatagataaagaggtt
gttttaaaagctcaggttttggttggcggtaggggaaaagctggaggaattttatttgca
tcaaataaggaggagtttataaaaaaggctgaggagctttttaataaagaggttaaagga
gaaaaagtagagaaaattttagttgaggaaaaattaccaatagagaaggaatattatgtt
tccatcattgttgatagagatgctaaaaagccattgattattttctctacaaaaggtggg
gtggatattgaagaaattgctgaaaaagagccagaaaaaattgtaaaataccatgtagat
gttaagaagccatttttaccttatgttgcaaggtggatagttaaagaggcaaaagtgcca
agtgaggagataggaaaggttgcagacatcatctacaagttatacaagatatttaaagat
tgggatgctacaatggtcgagataaaccctttagttataaccaaagataaaaatgtctat
gcagctgatgccgttatacacttagacgacgatgcagcgtttagacatagatatgaagaa
tttgaagaatttaaaaataaagaaaaactgccgtttgcatatgttgaattggatggagat
atagccgttataggtaatggggcaggtttaacgttggcaagtatggatgtcataaacaac
cttggaagaaagccagcatgttttttagatattggtggaggagcagatgctgaaactgta
aaattggctttaagaaaggttttagaaaacaaaaatgttaaagggatatttataaacata
ttggggggaataacaaggtgtgatgaagtagcaaagggaattgttgaggttttaaaggag
catccaaatataaaatttgcagttaggatgatgggaacaaatgaagatattggaaggaaa
gtattggaagagcatggaattccttatgaaacctcaatggaagaggctggaaagaaactt
attgagttgttgagctaa

DBGET integrated database retrieval system