KEGG   Methanocaldococcus fervens: Mefer_0470Help
Entry
Mefer_0470        CDS       T00976                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mfe  Methanocaldococcus fervens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_0470
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mefer_0470
   00640 Propanoate metabolism
    Mefer_0470
   00660 C5-Branched dibasic acid metabolism
    Mefer_0470
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mefer_0470
Enzymes [BR:mfe01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mefer_0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(447657..448754)
Genome map
AA seq 365 aa AA seqDB search
MKLHEYEAKNIFKEYGIPVPESFLISKEDDLSNIDIDKEVVLKAQVLVGGRGKAGGILFA
SNKEEFIKKAEELFNKEVKGEKVEKILVEEKLPIEKEYYVSIIVDRDAKKPLIIFSTKGG
VDIEEIAEKEPEKIVKYHVDVKKPFLPYVARWIVKEAKVPSEEIGKVADIIYKLYKIFKD
WDATMVEINPLVITKDKNVYAADAVIHLDDDAAFRHRYEEFEEFKNKEKLPFAYVELDGD
IAVIGNGAGLTLASMDVINNLGRKPACFLDIGGGADAETVKLALRKVLENKNVKGIFINI
LGGITRCDEVAKGIVEVLKEHPNIKFAVRMMGTNEDIGRKVLEEHGIPYETSMEEAGKKL
IELLS
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaagttacatgaatatgaagcaaaaaatatatttaaagagtatggtatcccagtaccc
gagagctttttaatatcaaaggaagatgacttaagcaacatagatatagataaagaggtt
gttttaaaagctcaggttttggttggcggtaggggaaaagctggaggaattttatttgca
tcaaataaggaggagtttataaaaaaggctgaggagctttttaataaagaggttaaagga
gaaaaagtagagaaaattttagttgaggaaaaattaccaatagagaaggaatattatgtt
tccatcattgttgatagagatgctaaaaagccattgattattttctctacaaaaggtggg
gtggatattgaagaaattgctgaaaaagagccagaaaaaattgtaaaataccatgtagat
gttaagaagccatttttaccttatgttgcaaggtggatagttaaagaggcaaaagtgcca
agtgaggagataggaaaggttgcagacatcatctacaagttatacaagatatttaaagat
tgggatgctacaatggtcgagataaaccctttagttataaccaaagataaaaatgtctat
gcagctgatgccgttatacacttagacgacgatgcagcgtttagacatagatatgaagaa
tttgaagaatttaaaaataaagaaaaactgccgtttgcatatgttgaattggatggagat
atagccgttataggtaatggggcaggtttaacgttggcaagtatggatgtcataaacaac
cttggaagaaagccagcatgttttttagatattggtggaggagcagatgctgaaactgta
aaattggctttaagaaaggttttagaaaacaaaaatgttaaagggatatttataaacata
ttggggggaataacaaggtgtgatgaagtagcaaagggaattgttgaggttttaaaggag
catccaaatataaaatttgcagttaggatgatgggaacaaatgaagatattggaaggaaa
gtattggaagagcatggaattccttatgaaacctcaatggaagaggctggaaagaaactt
attgagttgttgagctaa

DBGET integrated database retrieval system