KEGG   Methanocaldococcus fervens: Mefer_0534Help
Entry
Mefer_0534        CDS       T00976                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfe  Methanocaldococcus fervens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mefer_0534
   00052 Galactose metabolism
    Mefer_0534
   00500 Starch and sucrose metabolism
    Mefer_0534
   00520 Amino sugar and nucleotide sugar metabolism
    Mefer_0534
Enzymes [BR:mfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mefer_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
505298..506149
Genome map
AA seq 283 aa AA seqDB search
MVKKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVTGKGKQ
AIENHFDMNYELECKLEKSGKYELLKIIKEIDKLGNIFYVRQKEQKGLGDAISYGEDFVG
DEYFIAMVGDTIYSKNIVKDLIKAHKKYGCSVIALERVPKEEVHKYGVIEGEEIDDGAYK
IKNMVEKPKVEEAPSNLIITGAYLLSPKIFEKIKQTPPGRGGEVQITDAMNLLLKEEDIV
GIEIDCKRYDIGDVLGWLKANVEIGAEKLPEFREFLKEFVKNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaaagcagtgattccagtagctggttttggaactcgattgttgccaataacg
aaagcacagccaaaagaaatgcttccagtagttaataagccaatagttcagtatgtcgtt
gaggatttagtagaagcaggagtaaaagatattttgtttgtgactgggaagggaaagcag
gcaatagaaaaccactttgacatgaattatgaattagaatgcaaattagagaaatctgga
aaatatgaacttttaaaaattattaaagaaattgacaagttaggaaatatattttatgtt
aggcagaaagagcagaaaggtttgggcgatgccatctcatatggggaggactttgttggg
gatgaatactttatagcaatggttggagatacaatttactccaagaatattgtaaaggac
ttaataaaagcccataaaaaatacggttgctcagttattgcattagagagagttcctaag
gaagaagttcataagtatggagtaattgagggggaagagatagatgatggagcttacaaa
ataaaaaatatggttgaaaagccaaaggttgaagaagctccttcaaatttaattataaca
ggggcttatcttttatccccaaaaatatttgagaaaattaaacaaacacctcctggaaga
gggggagaggtgcaaattacagacgctatgaatttattattaaaggaggaggatattgta
gggattgagattgactgtaaaagatacgatattggggatgttcttggatggttaaaggca
aatgtagagattggagctgagaaacttcctgaatttagggagtttttaaaagaatttgtt
aaaaatttatga

DBGET integrated database retrieval system