KEGG   Methanocaldococcus fervens: Mefer_0534Help
Entry
Mefer_0534        CDS       T00976                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00040  Pentose and glucuronate interconversions
mfe00052  Galactose metabolism
mfe00500  Starch and sucrose metabolism
mfe00520  Amino sugar and nucleotide sugar metabolism
mfe01100  Metabolic pathways
mfe01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mefer_0534
   00052 Galactose metabolism
    Mefer_0534
   00500 Starch and sucrose metabolism
    Mefer_0534
   00520 Amino sugar and nucleotide sugar metabolism
    Mefer_0534
Enzymes [BR:mfe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mefer_0534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD Glyco_transf_88
Motif
Other DBs
NCBI-ProteinID: ACV24355
JGI: Mefer_0534
UniProt: C7P723
Position
505298..506149
Genome map
AA seq 283 aa AA seqDB search
MVKKAVIPVAGFGTRLLPITKAQPKEMLPVVNKPIVQYVVEDLVEAGVKDILFVTGKGKQ
AIENHFDMNYELECKLEKSGKYELLKIIKEIDKLGNIFYVRQKEQKGLGDAISYGEDFVG
DEYFIAMVGDTIYSKNIVKDLIKAHKKYGCSVIALERVPKEEVHKYGVIEGEEIDDGAYK
IKNMVEKPKVEEAPSNLIITGAYLLSPKIFEKIKQTPPGRGGEVQITDAMNLLLKEEDIV
GIEIDCKRYDIGDVLGWLKANVEIGAEKLPEFREFLKEFVKNL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaaagcagtgattccagtagctggttttggaactcgattgttgccaataacg
aaagcacagccaaaagaaatgcttccagtagttaataagccaatagttcagtatgtcgtt
gaggatttagtagaagcaggagtaaaagatattttgtttgtgactgggaagggaaagcag
gcaatagaaaaccactttgacatgaattatgaattagaatgcaaattagagaaatctgga
aaatatgaacttttaaaaattattaaagaaattgacaagttaggaaatatattttatgtt
aggcagaaagagcagaaaggtttgggcgatgccatctcatatggggaggactttgttggg
gatgaatactttatagcaatggttggagatacaatttactccaagaatattgtaaaggac
ttaataaaagcccataaaaaatacggttgctcagttattgcattagagagagttcctaag
gaagaagttcataagtatggagtaattgagggggaagagatagatgatggagcttacaaa
ataaaaaatatggttgaaaagccaaaggttgaagaagctccttcaaatttaattataaca
ggggcttatcttttatccccaaaaatatttgagaaaattaaacaaacacctcctggaaga
gggggagaggtgcaaattacagacgctatgaatttattattaaaggaggaggatattgta
gggattgagattgactgtaaaagatacgatattggggatgttcttggatggttaaaggca
aatgtagagattggagctgagaaacttcctgaatttagggagtttttaaaagaatttgtt
aaaaatttatga

DBGET integrated database retrieval system