KEGG   Methanocaldococcus fervens: Mefer_0560Help
Entry
Mefer_0560        CDS       T00976                                 

Definition
(GenBank) protein of unknown function DUF100
  KO
K01622  fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe00030  Pentose phosphate pathway
mfe00051  Fructose and mannose metabolism
mfe00680  Methane metabolism
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01120  Microbial metabolism in diverse environments
mfe01130  Biosynthesis of antibiotics
mfe01200  Carbon metabolism
mfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0560
   00030 Pentose phosphate pathway
    Mefer_0560
   00051 Fructose and mannose metabolism
    Mefer_0560
  Energy metabolism
   00680 Methane metabolism
    Mefer_0560
Enzymes [BR:mfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mefer_0560
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mefer_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_3
Motif
Other DBs
NCBI-ProteinID: ACV24381
JGI: Mefer_0560
UniProt: C7P749
Position
530343..531503
Genome map
AA seq 386 aa AA seqDB search
MENDKVTISVIKADVGGLCGHSLAPDELLEACEAVLEEAVDEIILDYYVTRCGDDIDLIM
SHKLGCDNEKVHKLAWDAFEEATKVAKELKLYGAGQDLLSDSFSGNVRGMGPGCAEMEFV
ERKSEPIVVFCCDKTDPTAFNYPLYKMFADPFNTAGLVFDPSMISGFKFEVHDIVGHKKV
FLDTPEEMYMLLALIGDYEKYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPVAIV
RAQSGFPAVGEVLEPFANPHFVPGWMRGSHWGPLMPVGEEDATPTRFDGPARIIALGFQV
CDGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPATMMEYTTVPKVLKALE
DRFIPLEGLELVEEGGITRKDRGEVE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgataaagtaacaatcagcgttataaaggcggatgttggaggtttatgtgga
cactcattagctccagatgagttgttagaagcttgtgaagctgttttggaggaggctgtt
gatgagataatattggattattatgtcacaagatgtggggatgatattgatttaataatg
agccacaaattaggttgcgataatgaaaaagttcataaattagcttgggatgcttttgaa
gaggcaacaaaagtagctaaagaactaaaactctatggagctggacaggatttattatct
gacagcttttcaggtaacgtcagaggtatgggtccaggatgtgctgagatggaatttgtt
gaaagaaagagtgagccaatcgttgttttctgctgtgataagactgatccaacagcattt
aactacccattatacaagatgttcgcagatccatttaacacagctggtttagttttcgac
ccttcaatgatttcaggatttaagtttgaagttcacgatattgttgggcataaaaaagta
tttttagacactccagaagagatgtatatgctcttagctttaattggagactatgagaag
tatgcaatcaaaagagtttatagaagaagagataatgaaattgctgctgttgtcagtact
gaaaaattaaactacatagctggggagtatgttggtaaagatgacccagttgctatagtt
agagctcaaagtggattcccagcagttggagaggtcttagagccatttgctaacccacac
tttgttccaggatggatgagaggtagccactggggtccattaatgccagttggagaagag
gatgcaacacctacaagatttgacggaccggcaagaattatagcattagggttccaagtt
tgcgatggaatgttaattggtcctaacgatttatttgcagataagggctttgataaggca
agagaaaaggcattagagatggcagatataataagaagaatgggtccattccaaccacac
agattaccagcaacaatgatggaatacacaacagttccaaaggttttaaaagctttagaa
gatagatttattcctttagaaggtttagagttagtagaagaggggggaattacaagaaaa
gatagaggagaagttgaatag

DBGET integrated database retrieval system