KEGG   Methanocaldococcus fervens: Mefer_0560Help
Entry
Mefer_0560        CDS       T00976                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_0560
   01230 Biosynthesis of amino acids
    Mefer_0560
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0560
   00030 Pentose phosphate pathway
    Mefer_0560
   00051 Fructose and mannose metabolism
    Mefer_0560
  Energy metabolism
   00680 Methane metabolism
    Mefer_0560
Enzymes [BR:mfe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Mefer_0560
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mefer_0560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
530343..531503
Genome map
AA seq 386 aa AA seqDB search
MENDKVTISVIKADVGGLCGHSLAPDELLEACEAVLEEAVDEIILDYYVTRCGDDIDLIM
SHKLGCDNEKVHKLAWDAFEEATKVAKELKLYGAGQDLLSDSFSGNVRGMGPGCAEMEFV
ERKSEPIVVFCCDKTDPTAFNYPLYKMFADPFNTAGLVFDPSMISGFKFEVHDIVGHKKV
FLDTPEEMYMLLALIGDYEKYAIKRVYRRRDNEIAAVVSTEKLNYIAGEYVGKDDPVAIV
RAQSGFPAVGEVLEPFANPHFVPGWMRGSHWGPLMPVGEEDATPTRFDGPARIIALGFQV
CDGMLIGPNDLFADKGFDKAREKALEMADIIRRMGPFQPHRLPATMMEYTTVPKVLKALE
DRFIPLEGLELVEEGGITRKDRGEVE
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgataaagtaacaatcagcgttataaaggcggatgttggaggtttatgtgga
cactcattagctccagatgagttgttagaagcttgtgaagctgttttggaggaggctgtt
gatgagataatattggattattatgtcacaagatgtggggatgatattgatttaataatg
agccacaaattaggttgcgataatgaaaaagttcataaattagcttgggatgcttttgaa
gaggcaacaaaagtagctaaagaactaaaactctatggagctggacaggatttattatct
gacagcttttcaggtaacgtcagaggtatgggtccaggatgtgctgagatggaatttgtt
gaaagaaagagtgagccaatcgttgttttctgctgtgataagactgatccaacagcattt
aactacccattatacaagatgttcgcagatccatttaacacagctggtttagttttcgac
ccttcaatgatttcaggatttaagtttgaagttcacgatattgttgggcataaaaaagta
tttttagacactccagaagagatgtatatgctcttagctttaattggagactatgagaag
tatgcaatcaaaagagtttatagaagaagagataatgaaattgctgctgttgtcagtact
gaaaaattaaactacatagctggggagtatgttggtaaagatgacccagttgctatagtt
agagctcaaagtggattcccagcagttggagaggtcttagagccatttgctaacccacac
tttgttccaggatggatgagaggtagccactggggtccattaatgccagttggagaagag
gatgcaacacctacaagatttgacggaccggcaagaattatagcattagggttccaagtt
tgcgatggaatgttaattggtcctaacgatttatttgcagataagggctttgataaggca
agagaaaaggcattagagatggcagatataataagaagaatgggtccattccaaccacac
agattaccagcaacaatgatggaatacacaacagttccaaaggttttaaaagctttagaa
gatagatttattcctttagaaggtttagagttagtagaagaggggggaattacaagaaaa
gatagaggagaagttgaatag

DBGET integrated database retrieval system