KEGG   Methanocaldococcus fervens: Mefer_0658Help
Entry
Mefer_0658        CDS       T00976                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_0658
   01230 Biosynthesis of amino acids
    Mefer_0658
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0658
   00030 Pentose phosphate pathway
    Mefer_0658
   00051 Fructose and mannose metabolism
    Mefer_0658
  Energy metabolism
   00680 Methane metabolism
    Mefer_0658
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mefer_0658
Enzymes [BR:mfe01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mefer_0658
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mefer_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
622381..623301
Genome map
AA seq 306 aa AA seqDB search
MVKKLRKKDIKVPLTVPESVKKEYISNYLELTKKTGNVMLFAGDQKMEHLNDDFFGEGIA
KEDASPEHLFNIASKGKICAFATQLGLIARYGMDYRKVPYIVKINSKTHLVKTRDPISKA
LVTVKDVVEFKENSGLNILGVGYTIYPGSEYEHIMFEEASKVILEAHKHGLIAILWSYPR
GKNVENERDPHLIAGAAGVAACLGADFVKVNYPKCDNPAERFKESVLAAGRTGVLCAGGK
SIEPEKFLKQIWEQINISGARGNATGRNIHQKPLDDAVRMCNAIYAITIEGKSLEDALKI
YYGDKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaactcagaaagaaggatataaaagttccattaacagttcctgaaagtgtc
aaaaaagagtatataagcaattatttggaattaacaaaaaagactggaaatgttatgtta
tttgctggagaccaaaagatggagcatttaaacgatgacttttttggggagggaattgcc
aaagaagatgcttctccagaacatctgtttaatatagcaagtaagggaaagatttgtgcc
tttgctactcagcttggtttaatagcaagatatggtatggattataggaaagttccttat
attgtgaagattaactcaaaaacgcatttagtcaaaacaagagacccaataagtaaagct
ttagtaacagttaaggacgttgtggagtttaaagaaaattctggactgaatatattggga
gttggttatacaatctatccaggaagtgaatatgagcacattatgtttgaagaagcatct
aaagttattttagaagctcacaaacatggactgattgcaatactttggagttatccaagg
gggaaaaatgttgagaatgaacgagaccctcatctaatcgctggagctgcaggagttgcc
gcatgtttaggagctgattttgttaaggttaattaccctaaatgtgataatccagctgag
agatttaaagaatcggttttagctgctggaagaactggagttttatgtgctggaggaaaa
agcatagagccagagaaatttttaaagcaaatttgggagcaaattaacataagtggagcc
agaggcaatgctacaggaagaaacatacatcaaaaaccattggatgatgctgtaaggatg
tgtaatgcaatatacgcaataaccattgaaggaaaaagtttagaagatgcgttaaaaata
tactacggggataaaaaataa

DBGET integrated database retrieval system