KEGG   Methanocaldococcus fervens: Mefer_0658Help
Entry
Mefer_0658        CDS       T00976                                 

Definition
(GenBank) Fructose-bisphosphate aldolase
  KO
K16305  fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe00030  Pentose phosphate pathway
mfe00051  Fructose and mannose metabolism
mfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfe00680  Methane metabolism
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01120  Microbial metabolism in diverse environments
mfe01130  Biosynthesis of antibiotics
mfe01200  Carbon metabolism
mfe01230  Biosynthesis of amino acids
Module
mfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0658
   00030 Pentose phosphate pathway
    Mefer_0658
   00051 Fructose and mannose metabolism
    Mefer_0658
  Energy metabolism
   00680 Methane metabolism
    Mefer_0658
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mefer_0658
Enzymes [BR:mfe01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Mefer_0658
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Mefer_0658
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC
Motif
Other DBs
NCBI-ProteinID: ACV24477
JGI: Mefer_0658
UniProt: C7P7E5
Position
622381..623301
Genome map
AA seq 306 aa AA seqDB search
MVKKLRKKDIKVPLTVPESVKKEYISNYLELTKKTGNVMLFAGDQKMEHLNDDFFGEGIA
KEDASPEHLFNIASKGKICAFATQLGLIARYGMDYRKVPYIVKINSKTHLVKTRDPISKA
LVTVKDVVEFKENSGLNILGVGYTIYPGSEYEHIMFEEASKVILEAHKHGLIAILWSYPR
GKNVENERDPHLIAGAAGVAACLGADFVKVNYPKCDNPAERFKESVLAAGRTGVLCAGGK
SIEPEKFLKQIWEQINISGARGNATGRNIHQKPLDDAVRMCNAIYAITIEGKSLEDALKI
YYGDKK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaactcagaaagaaggatataaaagttccattaacagttcctgaaagtgtc
aaaaaagagtatataagcaattatttggaattaacaaaaaagactggaaatgttatgtta
tttgctggagaccaaaagatggagcatttaaacgatgacttttttggggagggaattgcc
aaagaagatgcttctccagaacatctgtttaatatagcaagtaagggaaagatttgtgcc
tttgctactcagcttggtttaatagcaagatatggtatggattataggaaagttccttat
attgtgaagattaactcaaaaacgcatttagtcaaaacaagagacccaataagtaaagct
ttagtaacagttaaggacgttgtggagtttaaagaaaattctggactgaatatattggga
gttggttatacaatctatccaggaagtgaatatgagcacattatgtttgaagaagcatct
aaagttattttagaagctcacaaacatggactgattgcaatactttggagttatccaagg
gggaaaaatgttgagaatgaacgagaccctcatctaatcgctggagctgcaggagttgcc
gcatgtttaggagctgattttgttaaggttaattaccctaaatgtgataatccagctgag
agatttaaagaatcggttttagctgctggaagaactggagttttatgtgctggaggaaaa
agcatagagccagagaaatttttaaagcaaatttgggagcaaattaacataagtggagcc
agaggcaatgctacaggaagaaacatacatcaaaaaccattggatgatgctgtaaggatg
tgtaatgcaatatacgcaataaccattgaaggaaaaagtttagaagatgcgttaaaaata
tactacggggataaaaaataa

DBGET integrated database retrieval system