KEGG   Methanocaldococcus fervens: Mefer_0696Help
Entry
Mefer_0696        CDS       T00976                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mfe  Methanocaldococcus fervens
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mefer_0696
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mefer_0696
Enzymes [BR:mfe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Mefer_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(649794..651023)
Genome map
AA seq 409 aa AA seqDB search
MLIEEAIKLEKDLIKINSVNPSFGGKGEKEKAEYVKRKLIEYVDKYNIKNYTLKEYNTID
KYGIERPNIVFKIDFKKDRTLHIISHLDTVPEGDISLWETNPYEPVVKDGKIYGRGTEDN
HKGIVSSLLLLKMIFENNIEPKYNLSLIFVSDEEDGSEYGLKYLLNFEDEIFKKDDLIIV
PDFGTPTGEYIEIGEKGILWIKFNIKGRQCHGSTPENGLNANIVAFNFVNELYNNLYERF
NEINPIFLPEYSTFEPTILKNKVENPNTIPGYVEVVFDCRVLPTYTIDEILKFIDDFIKN
FDFKKYIKHYNRSVKVEITYDILKSENPNYSSENSEVVKELKKAIKKVLNREAKLCGMGG
GTVAAFLRCKGYDVAVWGIGEETAHQPNEHIKVEDLVKMAEVFYEILKQ
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgctgatagaggaagctataaagttggagaaagatttaataaaaataaattcagtaaat
ccttcatttggaggaaaaggagaaaaagaaaaggcagaatatgttaagagaaagttaatt
gagtatgttgataaatacaatataaaaaattacactctaaaagaatacaacactatagac
aaatatggcattgaaagaccaaacattgtatttaaaatagattttaaaaaagacagaaca
ttacatattatttctcatttggacactgttccagaaggggatatcagcttatgggaaaca
aatccttatgagcctgttgttaaggatgggaaaatctatggaagagggactgaagataac
cacaaagggatagtttcctccctacttttactaaagatgatttttgaaaacaacattgaa
ccaaaatacaatttatcattaatttttgtgtctgatgaagaagatggaagtgagtatggt
ttaaagtatttgttaaattttgaggatgagatatttaagaaggatgatttgattatagtt
ccagactttggaacacctactggtgaatacatagagattggagagaagggtattttatgg
ataaaattcaacattaaagggaggcagtgtcatggaagcacaccagaaaatgggctgaat
gccaatatagtagcttttaactttgtaaatgagctttacaataatttatatgagcgattt
aatgaaattaatccaatatttctgccagagtattcaacctttgaaccaacaatattaaaa
aataaggttgaaaacccaaatacaattccgggatatgttgaggttgtttttgactgcaga
gttttgccaacttatacaatagatgaaattttaaagtttatagatgattttataaaaaac
tttgactttaaaaaatatataaagcattataacagatcagtaaaggtagagataacttac
gatatattaaaatctgaaaatccaaattatagcagtgaaaactctgaagttgttaaagag
ttaaaaaaagcaataaaaaaggttttaaatagagaggcaaagctctgcggtatgggtggg
ggaactgttgcggcatttttgagatgtaagggatatgatgtagcggtttggggtattgga
gaagaaacagcccaccaacctaatgaacatattaaagtagaagatttagttaagatggct
gaagtgttttatgaaattttgaaacagtga

DBGET integrated database retrieval system