KEGG   Methanocaldococcus fervens: Mefer_0744Help
Entry
Mefer_0744        CDS       T00976                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mfe  Methanocaldococcus fervens
Brite
Enzymes [BR:mfe01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mefer_0744
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
692297..692950
Genome map
AA seq 217 aa AA seqDB search
MNLEEQKKAVIEKLIRERYIKSKRVIDALLKVPREEFVPEHLREYAYVDTPLEIGYGQTI
SAIHMVGMMCELLDLKPGMKVLEIGTGCGYHAAVTAEIVGKDGLVVSIERIPELAERAER
TLRKLGYDNVIIIVGDGTLGYEPLAPYDRIYATAAGPKIPEPLIKQLKDGGKLLMPVGRY
MQKLVLVEKKGDELIVKDCGPVAFVPLIGKEGFPSTF
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgaatttagaggagcaaaaaaaagctgttattgaaaagttaatcagggagaggtatata
aaaagtaaaagggttattgatgccttattaaaagttcctagagaggagtttgtccccgaa
catttaagagaatatgcttacgttgatacaccattagagattggttatggacagacgatc
tcagccattcacatggttggaatgatgtgtgagcttttagatctaaagccagggatgaaa
gttttagaaattggaactggatgtgggtatcacgcagcagtaactgccgaaatcgtgggg
aaagatggtttagttgtcagtattgaaagaattccagagttggctgaaagagcggagaga
actttgagaaagcttggatatgataatgttattataatagtgggggatggaactttaggt
tatgaaccattagccccttacgatagaatatatgcaactgcagcaggtccaaaaattcca
gaaccgttaataaagcagttaaaagacggaggaaagttattaatgcctgttggtagatat
atgcaaaaattggttttggttgagaagaaaggggatgagttgatagtaaaagactgcggt
cctgtagcatttgttcctttaattggtaaagaaggatttccatcaaccttttag

DBGET integrated database retrieval system