KEGG   Methanocaldococcus fervens: Mefer_0799Help
Entry
Mefer_0799        CDS       T00976                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mfe  Methanocaldococcus fervens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mefer_0799
Enzymes [BR:mfe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Mefer_0799
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
751269..752318
Genome map
AA seq 349 aa AA seqDB search
MAVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEVDNFGNLIAKRGDKGKKIMIAA
HMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVIVHGSKGDLIGVLGSKPPHRMKEE
ERNKLIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVHELGKNRLTGKAFDDRVGCA
VLLEVMKRLAEEDIDCQVYAVGTVQEEVGLKGARVSAFKINPDVAIALDVTIAGDHPGIK
KEDAPVDLGKGPVVGIVDASGRGLIAHPKVLEMVKAVSEKYKIDVQWEVGEGGTTDATAI
HLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYNCIKEVNNFF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggaatatttaaaaaagctctcaaaacttcatgggatatctggaagagaggat
agtgttagagagtttatgaaaaaagagttggaaaaatattgtgattctgttgaagtagat
aactttggaaatttaattgcaaaaagaggggataaaggcaaaaagattatgatagccgcc
cacatggatgagattggtttaatggttaaatatatagatgacaatggctttttaaaattc
acaaaaattgggggaatttacgacccaacaatattaaatcaaaaggttattgtccatgga
agtaaaggggatttaattggagttttaggttcaaaacctccacacaggatgaaagaagaa
gaaaggaataagttaattaaatatgaggacatgtttatagatattggggctgaaagtagg
gaagaagctatagagatgggggttaatataggaacatgggtctcatttttaagtgaagtt
cacgagttaggaaagaatagattaactggaaaggcgtttgatgatagagttggatgtgcc
gtattattagaggttatgaagagattggctgaagaagatattgactgccaagtctatgca
gttggaactgttcaggaagaagttggattaaaaggagctagagtttctgcctttaaaata
aatcctgatgttgctatcgcattggatgttaccatagcaggagaccacccaggaattaaa
aaagaagatgcaccagttgatttgggtaaaggaccggtagtaggaatagtagatgcatct
ggtaggggattaattgctcatccaaaggttttagagatggttaaagcagtttctgaaaaa
tacaaaatagatgttcagtgggaggttggagaaggaggaacaacagatgcaacagccatt
catttaacaagggagggaattccaacaggcgttatatcagttccagcaagatacatacat
acaccagttgaagtaattgacaaaagagatttagaaaaaactgttgaattagtttataac
tgtataaaagaggttaataatttcttctaa

DBGET integrated database retrieval system