KEGG   Methanocaldococcus fervens: Mefer_0799Help
Entry
Mefer_0799        CDS       T00976                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mfe  Methanocaldococcus fervens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
751269..752318
Genome map
AA seq 349 aa AA seqDB search
MAVEYLKKLSKLHGISGREDSVREFMKKELEKYCDSVEVDNFGNLIAKRGDKGKKIMIAA
HMDEIGLMVKYIDDNGFLKFTKIGGIYDPTILNQKVIVHGSKGDLIGVLGSKPPHRMKEE
ERNKLIKYEDMFIDIGAESREEAIEMGVNIGTWVSFLSEVHELGKNRLTGKAFDDRVGCA
VLLEVMKRLAEEDIDCQVYAVGTVQEEVGLKGARVSAFKINPDVAIALDVTIAGDHPGIK
KEDAPVDLGKGPVVGIVDASGRGLIAHPKVLEMVKAVSEKYKIDVQWEVGEGGTTDATAI
HLTREGIPTGVISVPARYIHTPVEVIDKRDLEKTVELVYNCIKEVNNFF
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcagtggaatatttaaaaaagctctcaaaacttcatgggatatctggaagagaggat
agtgttagagagtttatgaaaaaagagttggaaaaatattgtgattctgttgaagtagat
aactttggaaatttaattgcaaaaagaggggataaaggcaaaaagattatgatagccgcc
cacatggatgagattggtttaatggttaaatatatagatgacaatggctttttaaaattc
acaaaaattgggggaatttacgacccaacaatattaaatcaaaaggttattgtccatgga
agtaaaggggatttaattggagttttaggttcaaaacctccacacaggatgaaagaagaa
gaaaggaataagttaattaaatatgaggacatgtttatagatattggggctgaaagtagg
gaagaagctatagagatgggggttaatataggaacatgggtctcatttttaagtgaagtt
cacgagttaggaaagaatagattaactggaaaggcgtttgatgatagagttggatgtgcc
gtattattagaggttatgaagagattggctgaagaagatattgactgccaagtctatgca
gttggaactgttcaggaagaagttggattaaaaggagctagagtttctgcctttaaaata
aatcctgatgttgctatcgcattggatgttaccatagcaggagaccacccaggaattaaa
aaagaagatgcaccagttgatttgggtaaaggaccggtagtaggaatagtagatgcatct
ggtaggggattaattgctcatccaaaggttttagagatggttaaagcagtttctgaaaaa
tacaaaatagatgttcagtgggaggttggagaaggaggaacaacagatgcaacagccatt
catttaacaagggagggaattccaacaggcgttatatcagttccagcaagatacatacat
acaccagttgaagtaattgacaaaagagatttagaaaaaactgttgaattagtttataac
tgtataaaagaggttaataatttcttctaa

DBGET integrated database retrieval system