KEGG   Methanocaldococcus fervens: Mefer_0809Help
Entry
Mefer_0809        CDS       T00976                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01120  Microbial metabolism in diverse environments
mfe01130  Biosynthesis of antibiotics
mfe01200  Carbon metabolism
mfe01230  Biosynthesis of amino acids
Module
mfe_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mfe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0809
Enzymes [BR:mfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Mefer_0809
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C VraX
Motif
Other DBs
NCBI-ProteinID: ACV24627
JGI: Mefer_0809
UniProt: C7P7U5
Position
762320..763351
Genome map
AA seq 343 aa AA seqDB search
MPAKVLINGYGSIGKRVADAVSMQDDMEVIGVTKTKPDFEARLAVEKGYKLFVAIPDKER
VKLFEDAGIPVEGTILDVIEDVDIVVDGAPKKIGKENLENIYKPHKVKAILQGGEKAKDV
EDNFNALWSYDRCYGKDYIRVVSCNTTGLCRSLYAINSVADIKKARVVLVRRAADPNDDK
RGPVNAITPNPVTVPSHHGPDVVSVVPEFEGKILTSAVIVPTTLMHQHTLMVEVDGNFSR
DDVLEAINKTPRIITVKADEGFTSTAKIIEYGRDLGRLRYDINELVVWEESVNVLENEIF
LMQAVHQESIVIPENIDCIRAMLQMEEDNFKSIEKTNKAMGIQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagtattgataaatggatatggttcaattgggaagagggtagctgatgct
gtttcaatgcaggatgatatggaagttataggggttacaaagacgaagccagattttgaa
gcaagattggctgttgaaaaaggatacaagttatttgtagcaattccagacaaggagaga
gttaagttatttgaagacgctggaattccagttgagggaactattttagatgttatagag
gatgtagacatagttgttgatggagctccaaaaaagattggaaaagaaaacttagaaaat
atctacaaacctcacaaagttaaagctattcttcagggaggggaaaaggctaaagatgtt
gaagacaactttaatgcgttatggagctacgacagatgttatggaaaagactacataaga
gttgtctcatgcaacacaacaggtttgtgtagaagcttatatgcaataaactcagttgct
gacattaaaaaggcaagagttgttttggttagaagagctgcagatccaaacgatgataaa
agagggccagtaaatgctataacaccaaatccagttacagttccttcccatcacggtcct
gatgttgtttcagtagttccagagtttgaagggaagattttaacctccgctgttatagtt
ccaacaacattaatgcaccaacacactttaatggttgaagttgatggaaattttagcagg
gatgatgttttagaagctataaacaaaactccaagaattataactgttaaagctgatgag
ggatttacatcaacagctaaaattatcgagtatggaagagatttaggaaggttgaggtat
gatataaacgagttggttgtttgggaggagagcgttaacgtcttagaaaatgagatattc
ttaatgcaggctgtccatcaagagagtatagtaattcctgaaaacattgattgtattaga
gccatgctccaaatggaagaagataacttcaaatcaattgaaaaaacaaataaagctatg
ggcattcaataa

DBGET integrated database retrieval system