KEGG   Methanocaldococcus fervens: Mefer_0886Help
Entry
Mefer_0886        CDS       T00976                                 

Definition
(GenBank) pyruvate/ketoisovalerate oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00010  Glycolysis / Gluconeogenesis
mfe00020  Citrate cycle (TCA cycle)
mfe00620  Pyruvate metabolism
mfe00633  Nitrotoluene degradation
mfe00640  Propanoate metabolism
mfe00650  Butanoate metabolism
mfe00680  Methane metabolism
mfe00720  Carbon fixation pathways in prokaryotes
mfe01100  Metabolic pathways
mfe01120  Microbial metabolism in diverse environments
mfe01130  Biosynthesis of antibiotics
mfe01200  Carbon metabolism
Module
mfe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mfe_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0886
   00020 Citrate cycle (TCA cycle)
    Mefer_0886
   00620 Pyruvate metabolism
    Mefer_0886
   00640 Propanoate metabolism
    Mefer_0886
   00650 Butanoate metabolism
    Mefer_0886
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mefer_0886
   00680 Methane metabolism
    Mefer_0886
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mefer_0886
Enzymes [BR:mfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mefer_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ACV24704
JGI: Mefer_0886
UniProt: C7P822
Position
complement(833557..834093)
Genome map
AA seq 178 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RSQIYNPDYVIVQDATLLESVNVVEGLKKEGAVVINTVKDDLDLGFKTYIIDATGIALDV
LGVPIVNTAMVGAFAGVTKLVTLDSVKKAIMDTFKGKLGEKNAKAAEVAYNEMIKKYG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatcagatttcacggaagaggaggacaaggagctgttacagccgctcaaatt
ttagctaaagctgctttttatgatggaaaattctgccaagcattcccattttttggtgtt
gagagaagaggggcccctgttatggcatttacaagaatagatgataagaaaattacgttg
aggtctcaaatatacaacccagattatgttatagttcaagacgctacacttttggagagt
gttaatgttgttgaggggttaaagaaggagggagctgttgtaattaacactgttaaagat
gatttggatttaggatttaaaacttacataatcgatgctacaggtattgctttagatgtt
ttgggagttcctatagtaaatactgcaatggttggtgcatttgcaggagttaccaagctt
gttacacttgactcagttaaaaaggctataatggatacatttaaaggaaaattgggagag
aaaaacgctaaagcagctgaagtagcatacaatgaaatgataaagaagtatggataa

DBGET integrated database retrieval system