KEGG   Methanocaldococcus fervens: Mefer_0886Help
Entry
Mefer_0886        CDS       T00976                                 

Definition
(RefSeq) pyruvate ferredoxin oxidoreductase subunit gamma
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mefer_0886
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mefer_0886
   00020 Citrate cycle (TCA cycle)
    Mefer_0886
   00620 Pyruvate metabolism
    Mefer_0886
   00640 Propanoate metabolism
    Mefer_0886
   00650 Butanoate metabolism
    Mefer_0886
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mefer_0886
   00680 Methane metabolism
    Mefer_0886
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mefer_0886
Enzymes [BR:mfe01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mefer_0886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(833557..834093)
Genome map
AA seq 178 aa AA seqDB search
MIEIRFHGRGGQGAVTAAQILAKAAFYDGKFCQAFPFFGVERRGAPVMAFTRIDDKKITL
RSQIYNPDYVIVQDATLLESVNVVEGLKKEGAVVINTVKDDLDLGFKTYIIDATGIALDV
LGVPIVNTAMVGAFAGVTKLVTLDSVKKAIMDTFKGKLGEKNAKAAEVAYNEMIKKYG
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaatcagatttcacggaagaggaggacaaggagctgttacagccgctcaaatt
ttagctaaagctgctttttatgatggaaaattctgccaagcattcccattttttggtgtt
gagagaagaggggcccctgttatggcatttacaagaatagatgataagaaaattacgttg
aggtctcaaatatacaacccagattatgttatagttcaagacgctacacttttggagagt
gttaatgttgttgaggggttaaagaaggagggagctgttgtaattaacactgttaaagat
gatttggatttaggatttaaaacttacataatcgatgctacaggtattgctttagatgtt
ttgggagttcctatagtaaatactgcaatggttggtgcatttgcaggagttaccaagctt
gttacacttgactcagttaaaaaggctataatggatacatttaaaggaaaattgggagag
aaaaacgctaaagcagctgaagtagcatacaatgaaatgataaagaagtatggataa

DBGET integrated database retrieval system