KEGG   Methanocaldococcus fervens: Mefer_1145Help
Entry
Mefer_1145        CDS       T00976                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00340  Histidine metabolism
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mefer_1145
Enzymes [BR:mfe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mefer_1145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh RsmF_methylt_CI
Motif
Other DBs
NCBI-ProteinID: ACV24955
JGI: Mefer_1145
UniProt: C7P8S3
Position
1076254..1077546
Genome map
AA seq 430 aa AA seqDB search
MVTRMIIKKIKELTREEKEKIINRNKANFEEILPTVMEILKDVKEKGDEALKYYTKKFDG
VEIDNFKVTEEEIEEAYNSVDYKIVEAIEKARENIYYFHKKQMENIKDLKINKDGIILGQ
VVRAIEKVGCYVPGGRAFYPSTVLMTTIPAKVAGCEEIYITSPPTKEGKGNPSTLIAGDI
VGVSAIYKVGGVQAIGALAYGTETIPKVDIIVGPGNIYVTTAKKMVYGEVAIDFLAGPSE
VLIIADETANTEFVALDFIAQAEHDPNASCIIATTSETKAEEIKNKIFEEIERVERKDII
LKALENSAILIGDLEECIEFSNLYAPEHLEILTKNPDEVLNNIKHAGSVFLGDYSPVPVG
DYASGTNHVLPTSQFARMSSGLNVETFLKKITYQKLDKESLKNIADIVITLAEAEGLFGH
AEAVRRRLEK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggtgacaaggatgataatcaaaaaaattaaggaattaacgagagaagagaaggaaaaa
ataattaacaggaacaaagctaactttgaagaaatactgccaacagtcatggagatttta
aaggatgttaaggaaaaaggagatgaagctttaaagtattacacaaaaaaatttgatggc
gttgaaatagataattttaaagttacagaagaggagatagaagaagcttataactcagta
gattataaaattgttgaagcaatagaaaaagccagggaaaacatttattacttccacaaa
aagcagatggagaatataaaagatttaaaaataaataaagatggaataatattggggcag
gttgttagagcaatagaaaaagttggatgctacgttcctggagggagagcgttttatcct
tcaactgttttgatgacaacaatccctgcaaaggttgctggatgtgaagagatatatatc
acctctccaccaacaaaagaaggaaagggaaatccatctacattaatagcaggagatatc
gttggagtttcagcaatttacaaagttggaggagttcaggctataggagctttagcttac
ggaacggaaacaattccaaaagttgatattattgttgggccaggtaatatatatgtaaca
acggcaaaaaagatggtttatggggaggtagctattgatttcttagcaggaccttcggaa
gttttaattatcgccgatgaaacagcaaatacagaatttgttgcattggatttcattgct
caagctgaacacgaccctaacgcctcctgtataatagcaacaacctctgaaactaaggca
gaggaaattaaaaataaaatatttgaagagatagaaagagttgaaaggaaagatattatt
ttaaaagctttggaaaactctgccatattaattggtgatttagaagagtgtatagagttt
tcaaacttatatgctccagaacatttagaaatattaactaaaaatccagatgaggttttg
aataatattaaacatgctggaagtgtatttttaggagattatagccccgttccagttgga
gattatgcctctggaacaaatcatgttttgccaacgtcacagtttgcaagaatgagctct
ggtctaaatgtagaaacgtttttaaagaagataacttatcaaaaattagataaagaaagt
ttaaaaaacattgctgatattgttattacattggctgaggctgaagggttgtttggacac
gctgaagcggttagaaggaggttagaaaaatag

DBGET integrated database retrieval system