KEGG   Methanocaldococcus fervens: Mefer_1149Help
Entry
Mefer_1149        CDS       T00976                                 

Definition
histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mfe  Methanocaldococcus fervens
Brite
Enzymes [BR:mfe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Mefer_1149
Transfer RNA biogenesis [BR:mfe03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Mefer_1149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1079404..1081014
Genome map
AA seq 536 aa AA seqDB search
MDEKTKLMRCIIERILEEYKEGKTLDKKRIEQIKAECLRIHRIGIGHPSNSEILQYATEE
EKKILIPILRKKPVRTISGVAVVAVMTSPEKCPHGKCMFCPGGVGSVFGDVPQSYTGREP
ATMRGLMFGFDPYLQTKARIEQLEKVGHPTNKIELIIMGGTFPARDISYQDWFIKRCLDA
MNGVEASSLEEAQKINETAEHRCVALCVETRPDYCGEKEINQMLKLGATRVELGVQTIYN
EILEFCKRGHTVEDTIKATQLLKDSGLKVSYHLMPGMPGSDMEMDKKMFREIFENPDFKP
DMVKIYPCLVVKGTELYEMWKRGEYRPYREEEAIEIISYAKSIMPKWVRTSRIQRDIPAT
VIVDGVKKSNLGELVYKYMEKHGIKCKCIRCREVGHVMYKKGIMPEIEHIKLCREEYEAS
GGTEIFLSYEDVNNDILIAFLRLREPYKPFRKEIDENTMLVRQLHVCGQEKPLTKDLKEI
TWQHKGYGRKLLQEAERIAKEEFGKKKILVTSGIGVREYYRKLGYERIGPYMGKYL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaaaaacaaagttaatgagatgtatcattgagaggatattagaggagtataaa
gaaggaaaaacattagataaaaaaagaattgagcaaattaaagctgagtgtttgagaatt
catagaattggtattggacatccttcaaactctgaaattttgcagtatgctactgaagaa
gaaaaaaagattttaattccaatattaagaaaaaagccagttagaactatctccggagtt
gctgttgttgctgttatgacctctccagaaaaatgtccacatggaaagtgtatgttttgc
ccaggaggagttggaagcgtctttggagacgttcctcaaagctatactggaagagaaccg
gccactatgagaggtttgatgtttggctttgacccatatcttcaaacaaaggcaaggatt
gaacagttggaaaaggtaggacatccaacaaataagatagagcttattataatgggagga
acgtttccagcgagagatataagttatcaagattggtttattaagagatgcttagatgct
atgaacggagtagaggcgagtagcttagaagaggctcagaagataaatgaaactgcagag
catagatgtgttgctttgtgcgtagaaacaagacctgattattgtggagaaaaagagata
aatcaaatgttgaagttaggagctacaagggtagagttaggggttcaaacaatatacaat
gagattttggagttttgtaagagagggcatactgttgaggataccataaaagctactcag
ctattaaaagatagcggtttaaaggtctcttatcatttaatgccaggaatgccaggctct
gacatggagatggacaaaaaaatgtttagagagatttttgaaaatcctgattttaagcca
gatatggttaagatatacccatgcttagttgttaagggaactgagctttatgaaatgtgg
aagagaggggagtatagaccatatagagaggaagaggcaatagagataattagctatgca
aaatcaataatgccaaaatgggtaagaacttcaagaattcaaagggatattccagctaca
gtaatagttgatggagttaaaaagagtaatttgggagagctcgtttataaatatatggaa
aagcatggaattaaatgcaagtgtataagatgtagggaagtagggcatgtgatgtataaa
aaaggaataatgccagagatcgagcatataaaactatgtagggaggagtatgaagcaagt
ggcggaactgaaatatttttatcctatgaagatgtgaataatgatattttaatagcattt
ttaagattgagagagccatacaaaccatttagaaaagagattgatgaaaatactatgttg
gttagacagttgcatgtttgtgggcaagaaaaaccattaactaaggatttgaaggaaatt
acctggcaacataaagggtatggaagaaagcttttacaagaggcggaaagaatagcaaaa
gaagagtttggaaagaaaaagattttagtgacaagtggtattggtgttagggaatactat
agaaagttgggatatgagagaattgggccttatatgggcaaatatctataa

DBGET integrated database retrieval system