KEGG   Methanocaldococcus fervens: Mefer_1197Help
Entry
Mefer_1197        CDS       T00976                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Organism
mfe  Methanocaldococcus fervens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1121860..1122960
Genome map
AA seq 366 aa AA seqDB search
MQYIYPFTAIVGQEKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALADLLPEIEVVE
GCSFNCDPNGELCDICKEKKDKGGLKITKKKMKVVNLPIGATEDRVIGTLDIEKAIKEGI
KALEPGILAEANRNILYIDEVNLLDDHIVDVLLDAAAMGWNIIEREGVKIKHPSRFILVG
TMNPEEGELRPQILDRFGLMVDVEGLTDIKDRVEVIKRVEEFNNNPEEFYKKFEEEQNKL
REKIIKAREILKDVEISDELLEFISKVCIELGIQTNRADITVVRTAKALAAYNGRTKVTL
DDVKEAMELALPHRMRRKPFEPPQLNKEKLEQMINEFEQQINKNEEEKEKEEKKENNDVK
KKTRIN
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatatttatccattcactgcaatcgttggacaggagaagatgaagaaggcttta
attttaaatgcaataaatccaaagattggtggagttttaattagaggagagaagggaaca
gcaaaatccactgctgttagagctttagctgatttacttccagagattgaagttgttgaa
ggctgttcattcaactgcgaccctaatggagagctgtgtgatatctgcaaagaaaagaag
gataaaggaggattaaaaataacaaaaaagaaaatgaaagttgttaatcttccaataggg
gctactgaagatagagttattggaactttagatatagagaaagcaataaaagaaggaatt
aaagcattggagccaggtattttggcagaggcaaatagaaacatcctatacattgatgaa
gttaatttgttagatgaccatatagttgatgttctattggatgctgcagcaatggggtgg
aatattattgaaagggaaggagttaagataaagcatccttcaagattcatattagttgga
actatgaaccctgaagaaggagagctgagacctcaaattttagataggtttggtttaatg
gttgatgttgagggattaactgatattaaggatagagtagaggttataaagagagttgaa
gaatttaataataatccagaggaattttacaaaaaatttgaagaagagcaaaataaatta
agagagaagataattaaagcgagagaaattttaaaagatgttgagattagcgatgaactc
ttagaatttatatctaaagtttgtattgaattgggaattcaaaccaatagggcggatata
acggttgttagaactgctaaggcgttggcagcctacaacggaagaacaaaggtaactttg
gatgatgttaaagaggcgatggagttagctcttccacatagaatgaggagaaaaccgttt
gaaccaccacaattaaataaggaaaaattagagcagatgattaatgaatttgagcaacaa
ataaataaaaatgaagaagagaaagaaaaagaggaaaaaaaggaaaataatgacgtaaaa
aaaaaaacaagaataaattaa

DBGET integrated database retrieval system