KEGG   Methanocaldococcus fervens: Mefer_1198Help
Entry
Mefer_1198        CDS       T00976                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mfe  Methanocaldococcus fervens
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Mefer_1198
Enzymes [BR:mfe01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Mefer_1198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1123164..1123904
Genome map
AA seq 246 aa AA seqDB search
MRGRYIKFKPANDKIVDIAFDATFRRAAIHQKKRREKANKKLAIYLEREDIVEKVRQRKI
SSHILFVVDASGSMGAMKRMEAAKGAIISLLLDAYQKRNKIGMIAFRKDRAELILPFTSS
VELGEKLLKDLPTGGKTPLADAFIKSYEVFDREIRKNPNIIPIMIVISDFKPNVAVKGDY
IKEVFDACEKIVEKGINVVLIDTEPQSFIKIGIGKEIADRFGFKYYKIEELSKDKLLDIC
KGFVEY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagagggagatacattaaatttaaacctgcaaatgataaaatcgttgatattgccttt
gatgcaacatttagaagagccgctattcaccaaaaaaagagaagagagaaagcaaataaa
aaattagctatatatttggagagagaagacatcgtcgagaaagttaggcagaggaagata
tcttcccacatattgtttgttgtagatgcaagtggttcaatgggagctatgaaaaggatg
gaagccgctaaaggggctataatatccctactcttagatgcttatcaaaaaaggaataaa
attggaatgattgcatttagaaaagatagggctgagcttattttaccttttacatcttca
gtagagcttggggaaaaactactaaaagatttaccaacagggggaaaaactcctttagct
gatgcgtttataaaaagttatgaggtttttgatagggaaataaggaaaaatcctaatatt
atcccaataatgattgtgataagtgattttaaaccaaatgtggctgttaaaggagattac
attaaagaggtttttgatgcatgtgagaagatagttgaaaaaggaattaacgttgtatta
attgacacagaaccacaatcctttataaaaattggaattggaaaagaaatagctgataga
tttggatttaaatattacaaaatagaagaattgagcaaagataagctcttggatatttgt
aagggttttgtagaatattag

DBGET integrated database retrieval system