KEGG   Methanocaldococcus fervens: Mefer_1259Help
Entry
Mefer_1259        CDS       T00976                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mefer_1259
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mefer_1259
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mefer_1259
Enzymes [BR:mfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mefer_1259
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1185743..1186948
Genome map
AA seq 401 aa AA seqDB search
MKRYKDKYPDENGKFGIYGGKFVPETLMPAITELEEAFKRFWINNEGNFREEYFALLRDY
VGRPTPLYYAERLSEELGCKVYLKREDLAHLGAHKINNALGQALLAKKMGKTRVIAETGA
GQHGVATAAACAKLGLECVIYMGAKDVERQKLNVFRMELMGAKVIPVFGGSQTLKDAVNE
ALRDWTTNVRNTHYLLGSALGPHPYPMMVREFQRVIGKEIKEQILEKEGRLPDVIVACVG
GGSNAIGAFYEFLDDDVELYAVEAGGKGIETGMHGASLCAGEIGVLHGAKIYVKEDEFGQ
IEESYSISAGLDYPGVGPELSFLKDEGRIKAVYVTDDEALEAFQLLCRLEGILPALESSH
ALAYAVKLADKLDKDDIMVINLSGRGDKDVQTVAKALGREI
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
ttgaagagatacaaagataaatatccggatgaaaatggaaagtttggaatatacggaggt
aaatttgttccagaaacgttaatgcctgcaataactgagttggaggaagcttttaagaga
ttttggataaacaatgaagggaattttagagaggaatattttgccttgttaagagattat
gtagggagaccaacgccattgtattacgctgaaaggttgagtgaagaacttggctgtaaa
gtttatttaaagagggaggatttagctcacttaggagctcataaaataaataacgctttg
ggacaggctttattagctaaaaaaatgggtaaaacgagagttatagcagagacaggagct
ggacagcatggagtagccactgctgcagcatgtgctaaacttgggttagaatgtgttata
tacatgggagctaaggatgttgagaggcagaagttgaatgtctttaggatggagttaatg
ggagctaaagtaattcccgtatttggaggatcacaaacactaaaagatgctgtaaacgaa
gctttgagggattggacaactaacgttagaaacactcattatctacttggttccgcttta
gggcctcacccatatccaatgatggttagagaattccaaagagttattggtaaagaaatt
aaagaacaaatactggagaaggaaggaaggttgccagatgttattgttgcatgtgttggt
ggaggtagcaatgccataggggcattttatgaattcttagatgatgatgttgaattatat
gccgttgaagctggaggaaagggaattgaaacaggaatgcatggagcttcgttgtgtgct
ggagagataggggttttacatggagctaagatttatgttaaagaggatgagtttgggcag
atagaggagagttatagtatttcagcaggtttagattatccaggagtaggtcctgagctt
tcatttttaaaggatgagggaaggattaaagcagtttatgtaactgatgatgaagcttta
gaggctttccaactactatgtagattagagggtatattaccagcattggaaagctctcat
gctttagcttatgccgttaagttagctgataagttagataaagatgatataatggttatt
aacctatctggaagaggagataaagacgttcaaacggttgctaaagcattaggtagggag
atttaa

DBGET integrated database retrieval system