KEGG   Methanocaldococcus fervens: Mefer_1260Help
Entry
Mefer_1260        CDS       T00976                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mfe  Methanocaldococcus fervens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mefer_1260
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mefer_1260
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mefer_1260
Enzymes [BR:mfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mefer_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1186964..1187803
Genome map
AA seq 279 aa AA seqDB search
MKIEEKFEELKNKGEKAFVAFYVGGDPNLEISEKALEVICKYADIVEIGIPFSDPVADGI
TIQKADVRALSSGMNPLKAFELAKKLSEKFPNTPKVFLTYYNIIFKMGEEEFVKKCKESG
VSGIIVPDLPIEEADSLYNYCKKYGVDLIFLVAPTTPDERLKRILEKCSGFVYVVSVTGT
TGAREKIAEETKELVRRVKKYSKIPACVGFGISKKEHVEEITEIADGAIVGSAIVKIVEK
HLDENGQIKDEEKFLKDLEEFVKNLKEGTKKKVKATAKN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaagaaaaatttgaagaattaaaaaataaaggggaaaaagcatttgttgca
ttttatgtgggaggagatccaaacttagaaatttcagagaaagctttagaggttatttgt
aagtatgcagatattgttgagataggtatcccattttccgaccctgttgcagatgggatt
acaatacaaaaggcagatgttagggctttgagtagtgggatgaatcctttaaaagcgttt
gaattggctaaaaagttgagtgagaagtttccaaacactccaaaggtgtttttaacctat
tataatataatattcaaaatgggtgaggaggagtttgttaaaaaatgcaaagaatcaggg
gtttcaggaattatagttcctgatttaccaattgaggaagcagatagcttatacaactac
tgcaaaaaatatggtgttgatttaatatttttggtagctccaacaacgcctgatgagaga
ttaaagagaattttagaaaagtgtagtggatttgtctatgttgtgtctgtaactgggact
actggagcgagagaaaaaattgctgaagaaacgaaggaacttgttaggagagttaaaaag
tattcaaaaattcctgcatgcgtagggtttggaatatcaaagaaagagcacgttgaggaa
ataactgagatagctgatggggctattgtaggaagtgcaattgttaagatcgttgagaaa
catttggatgaaaatggacagataaaggatgaggaaaaattcttgaaagatttggaagag
tttgttaaaaatttgaaagaagggactaaaaagaaagttaaagcaactgcaaagaactaa

DBGET integrated database retrieval system