KEGG   Methanocaldococcus fervens: Mefer_1260Help
Entry
Mefer_1260        CDS       T00976                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mfe  Methanocaldococcus fervens
Pathway
mfe00260  Glycine, serine and threonine metabolism
mfe00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mfe01100  Metabolic pathways
mfe01110  Biosynthesis of secondary metabolites
mfe01130  Biosynthesis of antibiotics
mfe01230  Biosynthesis of amino acids
Module
mfe_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mfe00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mefer_1260
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mefer_1260
Enzymes [BR:mfe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mefer_1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth BtpA PcrB Ribul_P_3_epim
Motif
Other DBs
NCBI-ProteinID: ACV25069
JGI: Mefer_1260
UniProt: C7P937
Position
1186964..1187803
Genome map
AA seq 279 aa AA seqDB search
MKIEEKFEELKNKGEKAFVAFYVGGDPNLEISEKALEVICKYADIVEIGIPFSDPVADGI
TIQKADVRALSSGMNPLKAFELAKKLSEKFPNTPKVFLTYYNIIFKMGEEEFVKKCKESG
VSGIIVPDLPIEEADSLYNYCKKYGVDLIFLVAPTTPDERLKRILEKCSGFVYVVSVTGT
TGAREKIAEETKELVRRVKKYSKIPACVGFGISKKEHVEEITEIADGAIVGSAIVKIVEK
HLDENGQIKDEEKFLKDLEEFVKNLKEGTKKKVKATAKN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaagatagaagaaaaatttgaagaattaaaaaataaaggggaaaaagcatttgttgca
ttttatgtgggaggagatccaaacttagaaatttcagagaaagctttagaggttatttgt
aagtatgcagatattgttgagataggtatcccattttccgaccctgttgcagatgggatt
acaatacaaaaggcagatgttagggctttgagtagtgggatgaatcctttaaaagcgttt
gaattggctaaaaagttgagtgagaagtttccaaacactccaaaggtgtttttaacctat
tataatataatattcaaaatgggtgaggaggagtttgttaaaaaatgcaaagaatcaggg
gtttcaggaattatagttcctgatttaccaattgaggaagcagatagcttatacaactac
tgcaaaaaatatggtgttgatttaatatttttggtagctccaacaacgcctgatgagaga
ttaaagagaattttagaaaagtgtagtggatttgtctatgttgtgtctgtaactgggact
actggagcgagagaaaaaattgctgaagaaacgaaggaacttgttaggagagttaaaaag
tattcaaaaattcctgcatgcgtagggtttggaatatcaaagaaagagcacgttgaggaa
ataactgagatagctgatggggctattgtaggaagtgcaattgttaagatcgttgagaaa
catttggatgaaaatggacagataaaggatgaggaaaaattcttgaaagatttggaagag
tttgttaaaaatttgaaagaagggactaaaaagaaagttaaagcaactgcaaagaactaa

DBGET integrated database retrieval system